Player Sindorei_Spite at slot wrists has inconsistency between name 'sindoreis_spite' and 'sindorei_spite' for id 132379

Player Magistrike's_Restraints at slot wrists has inconsistency between name 'magistrikes_restraints' and 'magistrike_restraints' for id 132407

close

SimulationCraft 715-01

for World of Warcraft 7.1.5 Live (wow build level 23244, git build 7e8c59f)

Current simulator hotfixes

Aran's Relaxing Ruby

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-11-08 In-game testing shows that the actual rppm is 1.7 rather than 0.92. We slightly underestimate at 1.65 here.
Flame Wreath rppm 1.65 0.92

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-12-18 Incorrect spell level for starfall damage component.
Starfall spell_level 40.00 76.00

Horrific Appendages

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-09 In-game testing shows that the actual rppm is much closer to 1.3~ than 0.7, so we slightly underestimated down to 1.25.
Horrific Appendages rppm 1.25 0.70

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
(effect#1) base_value 0.00 0.00 Verification Failure (10.00)

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-11-30 Reverse the incorrect AC mana cost adjustment from 60& back to 120%
Arcane Charge (effect#2) base_value 120.00 60.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Alythyss : 968036 dps, 562927 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
968036.1 968036.1 617.2 / 0.064% 122194.5 / 12.6% 30.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
25940.3 25940.3 Mana 0.00% 52.3 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Alythyss 968036
Chaos Bolt 295675 30.6% 60.1 4.85sec 1478558 1014218 Direct 116.0 0 766538 766538 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.15 116.01 0.00 0.00 1.4578 0.0000 88928651.68 88928651.68 0.00 1014217.87 1014217.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 116.01 100.00% 766538.41 535878 1064079 766844.78 732508 810783 88928652 88928652 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 106582 11.0% 49.3 6.09sec 649305 639125 Direct 98.6 183759 426843 324786 58.0%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.33 98.63 0.00 0.00 1.0159 0.0000 32032963.63 32032963.63 0.00 639125.37 639125.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.41 41.98% 183758.91 129233 256614 183797.84 167379 201239 7609064 7609064 0.00
crit 57.22 58.02% 426842.53 258573 612203 426850.06 379508 467920 24423899 24423899 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 14620 1.5% 33.4 4.95sec 129397 0 Direct 33.4 108426 216848 129397 19.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.38 33.38 0.00 0.00 0.0000 0.0000 4319442.87 4319442.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.92 80.66% 108426.12 87244 115162 108421.32 103344 113142 2919357 2919357 0.00
crit 6.46 19.34% 216847.53 174488 230324 216640.94 0 230324 1400085 1400085 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 240706 24.9% 20.3 14.99sec 3571399 3465502 Direct 39.1 125540 251176 189941 51.3%  
Periodic 304.1 141074 282132 213429 51.3% 196.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.26 39.12 304.14 304.14 1.0306 1.9469 72342344.29 72342344.29 0.00 118011.69 3465501.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.06 48.74% 125539.51 89669 178031 125508.40 108020 141012 2393383 2393383 0.00
crit 20.05 51.26% 251176.34 179319 356067 251143.32 220168 285708 5036447 5036447 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.1 48.70% 141073.57 81 456168 141247.58 120402 163337 20897166 20897166 0.00
crit 156.0 51.30% 282131.66 149 871185 282480.73 247175 322766 44015349 44015349 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 123074 12.8% 78.0 3.68sec 475381 400563 Direct 150.2 207073 414088 246869 19.2%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.00 150.20 0.00 0.00 1.1868 0.0000 37079328.18 37079328.18 0.00 400563.13 400563.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.33 80.78% 207072.79 144942 287793 207055.17 195720 217663 25123075 25123075 0.00
crit 28.87 19.22% 414088.14 289870 575578 414039.92 373297 468106 11956253 11956253 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10134 1.0% 20.5 14.67sec 148812 0 Direct 20.5 124779 249423 148815 19.3%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.47 20.47 0.00 0.00 0.0000 0.0000 3045523.82 3045523.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.52 80.72% 124779.17 109698 144802 124791.28 118230 135148 2061322 2061322 0.00
crit 3.95 19.28% 249422.51 219396 289603 244855.18 0 289603 984202 984202 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 43771 / 43771
Firebolt 43771 4.5% 111.0 2.71sec 118513 97203 Direct 110.2 100101 200201 119427 19.3%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.05 110.20 0.00 0.00 1.2192 0.0000 13160567.43 13160567.43 0.00 97202.72 97202.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.92 80.69% 100101.05 64723 116502 100105.38 97872 102278 8901266 8901266 0.00
crit 21.28 19.31% 200200.53 129446 233004 200230.47 183382 216823 4259301 4259301 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 124619 / 39687
Firebolt 124619 4.1% 49.3 5.52sec 241512 209896 Direct 49.0 203561 407060 242851 19.3%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.27 49.00 0.00 0.00 1.1506 0.0000 11900501.28 11900501.28 0.00 209896.49 209896.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.54 80.69% 203561.30 129446 233004 203715.63 197235 211708 8049184 8049184 0.00
crit 9.46 19.31% 407059.58 258893 466007 407317.24 0 466007 3851318 3851318 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 112449 / 9515
Immolation 86561 0.7% 1.0 0.00sec 2164112 0 Periodic 45.7 39673 79335 47314 19.3% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.87 45.74 0.0000 1.0775 2164111.79 2164111.79 0.00 87818.52 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 80.74% 39672.81 34281 41137 39673.83 38851 40892 1465066 1465066 0.00
crit 8.8 19.26% 79335.40 68561 82274 79333.22 68561 82274 699046 699046 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25888 0.2% 22.9 1.08sec 28300 26264 Direct 22.9 23725 47441 28300 19.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.87 22.87 0.00 0.00 1.0775 0.0000 647221.18 951476.45 31.98 26263.90 26263.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.46 80.71% 23724.70 20500 24600 23725.40 23023 24600 437908 643766 31.98
crit 4.41 19.29% 47440.77 41000 49200 47032.39 0 49200 209313 307710 31.70
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 98168 / 8297
Doom Bolt 98168 0.8% 11.0 2.20sec 222966 101292 Direct 11.0 187224 374282 222975 19.1%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.01 11.01 0.00 0.00 2.2013 0.0000 2454298.58 2454298.58 0.00 101291.73 101291.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.90 80.89% 187223.68 181003 217204 187200.06 181003 217204 1666921 1666921 0.00
crit 2.10 19.11% 374282.14 362007 434408 337105.63 0 434408 787378 787378 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 112417 / 9512
Immolation 86550 0.7% 1.0 0.00sec 2163826 0 Periodic 45.7 39673 79330 47307 19.2% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.87 45.74 0.0000 1.0775 2163825.86 2163825.86 0.00 87806.92 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 80.75% 39673.49 34281 41137 39674.19 38644 40708 1465352 1465352 0.00
crit 8.8 19.25% 79329.73 68561 82274 79309.93 68561 82274 698474 698474 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25868 0.2% 22.9 1.08sec 28278 26243 Direct 22.9 23722 47463 28278 19.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.87 22.87 0.00 0.00 1.0775 0.0000 646717.24 950735.61 31.98 26243.45 26243.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.48 80.81% 23722.01 20500 24600 23722.44 23023 24600 438412 644507 31.98
crit 4.39 19.19% 47463.41 41000 49200 47053.55 0 49200 208305 306228 31.70
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 112419 / 9514
Immolation 86543 0.7% 1.0 0.00sec 2163667 0 Periodic 45.7 39674 79321 47303 19.2% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.87 45.74 0.0000 1.0775 2163667.47 2163667.47 0.00 87800.49 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 80.76% 39674.47 34281 41137 39675.46 38851 40745 1465510 1465510 0.00
crit 8.8 19.24% 79321.48 68561 82274 79321.88 68561 82274 698157 698157 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25876 0.2% 22.9 1.08sec 28287 26252 Direct 22.9 23728 47417 28288 19.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.87 22.87 0.00 0.00 1.0775 0.0000 646931.69 951050.87 31.98 26252.15 26252.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.47 80.75% 23727.58 20500 24600 23728.33 22892 24600 438198 644192 31.98
crit 4.40 19.25% 47416.56 41000 49200 47052.79 0 49200 208734 306859 31.73
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 112468 / 9517
Immolation 86580 0.7% 1.0 0.00sec 2164592 0 Periodic 45.7 39670 79356 47324 19.3% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.87 45.74 0.0000 1.0775 2164591.77 2164591.77 0.00 87838.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.9 80.71% 39670.30 34281 41137 39671.30 38851 40680 1464586 1464586 0.00
crit 8.8 19.29% 79356.43 68561 82274 79364.04 68561 82274 700006 700006 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25888 0.2% 22.9 1.08sec 28300 26264 Direct 22.9 23724 47450 28299 19.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.87 22.87 0.00 0.00 1.0775 0.0000 647214.21 951466.20 31.98 26263.61 26263.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.46 80.71% 23723.57 20500 24600 23724.06 23136 24600 437915 643777 31.98
crit 4.41 19.29% 47450.23 41000 49200 47044.04 0 49200 209299 307689 31.71
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 118743 / 20207
Shadow Bolt 118743 2.1% 4.4 59.37sec 1376025 0 Periodic 46.8 108090 216257 129045 19.4% 19.8%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.39 0.00 47.10 46.84 0.0000 1.2682 6044808.61 6044808.61 0.00 101202.22 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.8 80.63% 108089.73 109 126576 107948.55 0 126576 4082576 4082576 0.00
crit 9.1 19.37% 216256.56 221 253152 214743.54 0 253152 1962233 1962233 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 139232 / 9614
Chaos Bolt 139232 1.0% 4.4 59.21sec 660861 325110 Direct 4.3 0 665064 665064 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 4.33 0.00 0.00 2.0329 0.0000 2881777.75 2881777.75 0.00 325110.31 325110.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.33 100.00% 665063.67 629106 754927 665718.42 0 754927 2881778 2881778 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 239641 / 18019
Chaos Barrage 239641 1.9% 4.4 59.01sec 1229694 0 Periodic 147.9 30562 61120 36466 19.3% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.39 0.00 148.69 147.95 0.0000 0.1602 5394939.65 5394939.65 0.00 226544.87 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.4 80.68% 30562.42 154 34809 30522.84 0 34809 3648103 3648103 0.00
crit 28.6 19.32% 61120.38 309 69619 61043.40 0 69619 1746837 1746837 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Alythyss
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alythyss
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.96sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.1 23.40sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.06 0.00 0.00 0.00 0.9850 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alythyss
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alythyss
  • harmful:false
  • if_expr:
 
Havoc 15.1 20.65sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.07 0.00 0.00 0.00 1.0429 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.3 20.43sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.27 0.00 0.00 0.00 0.9765 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 92.04sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 0.9540 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.25sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0550 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7526 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.40% 78.40% 1.4(1.4) 19.3

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.77%
  • accelerando_2:24.56%
  • accelerando_3:14.61%
  • accelerando_4:6.53%
  • accelerando_5:2.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 181.0sec 181.0sec 6.84% 7.41% 0.0(0.0) 2.0

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.62% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.6 0.0 12.1sec 12.1sec 49.23% 47.93% 0.0(0.0) 0.5

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.23%

Trigger Attempt Success

  • trigger_pct:49.93%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.5sec 69.5sec 8.73% 8.73% 0.0(0.0) 3.2

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.73%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.0 35.1 11.8sec 4.9sec 60.90% 68.80% 35.1(35.1) 25.4

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:60.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 6.8 8.5 45.9sec 20.4sec 98.06% 96.57% 47.8(47.8) 5.8

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:98.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.93% 97.93% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.8sec 69.0sec 13.56% 13.56% 0.0(0.0) 3.3

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.56%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 128.3sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 121.2sec 121.2sec 17.73% 17.73% 0.0(0.0) 2.7

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.4 59.4sec
chaos_tear 4.4 59.2sec
chaos_portal 4.4 59.3sec
dimension_ripper 3.9 54.2sec

Resources

Resource Usage Type Count Total Average RPE APR
Alythyss
chaos_bolt Soul Shard 61.1 122.3 2.0 2.0 727190.6
havoc Mana 15.1 1326149.4 88000.0 87999.8 0.0
immolate Mana 20.3 1336890.9 66000.0 65999.7 54.1
incinerate Mana 78.0 5147881.2 66000.0 65999.2 7.2
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 111.0 4441.9 40.0 40.0 2962.8
pet - service_imp
firebolt Energy 49.3 1971.0 40.0 40.0 6037.8
pet - doomguard
doom_bolt Energy 11.0 385.3 35.0 35.0 6370.5
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.27 3598721.81 (46.86%) 235604.52 1441836.02 28.60%
immolate Soul Shard 69.10 68.28 (53.89%) 0.99 0.82 1.18%
conflagrate Soul Shard 49.33 49.26 (38.87%) 1.00 0.08 0.16%
mp5_regen Mana 491.73 4080450.08 (53.14%) 8298.10 652175.77 13.78%
soulsnatcher Soul Shard 9.17 9.17 (7.24%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1876.19 4275.92 (100.00%) 2.28 22.81 0.53%
pet - service_imp
energy_regen Energy 434.02 1372.25 (100.00%) 3.16 63.84 4.45%
pet - doomguard
energy_regen Energy 11.01 350.18 (100.00%) 31.81 45.65 11.53%
Resource RPS-Gain RPS-Loss
Health 0.00 16005.08
Mana 25502.67 25940.29
Soul Shard 0.42 0.42
Combat End Resource Mean Min Max
Mana 966419.52 401602.30 1100000.00
Soul Shard 1.79 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 12.8%

Statistics & Data Analysis

Fight Length
Sample Data Alythyss Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Alythyss Damage Per Second
Count 9999
Mean 968036.12
Minimum 873140.81
Maximum 1085677.96
Spread ( max - min ) 212537.15
Range [ ( max - min ) / 2 * 100% ] 10.98%
Standard Deviation 31489.6748
5th Percentile 918650.91
95th Percentile 1022259.57
( 95th Percentile - 5th Percentile ) 103608.66
Mean Distribution
Standard Deviation 314.9125
95.00% Confidence Intervall ( 967418.90 - 968653.33 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4065
0.1 Scale Factor Error with Delta=300 8464865
0.05 Scale Factor Error with Delta=300 33859459
0.01 Scale Factor Error with Delta=300 846486469
Priority Target DPS
Sample Data Alythyss Priority Target Damage Per Second
Count 9999
Mean 562927.44
Minimum 509956.45
Maximum 635177.98
Spread ( max - min ) 125221.53
Range [ ( max - min ) / 2 * 100% ] 11.12%
Standard Deviation 18999.5162
5th Percentile 532906.21
95th Percentile 595277.34
( 95th Percentile - 5th Percentile ) 62371.13
Mean Distribution
Standard Deviation 190.0047
95.00% Confidence Intervall ( 562555.04 - 563299.84 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4376
0.1 Scale Factor Error with Delta=300 3081547
0.05 Scale Factor Error with Delta=300 12326187
0.01 Scale Factor Error with Delta=300 308154672
DPS(e)
Sample Data Alythyss Damage Per Second (Effective)
Count 9999
Mean 968036.12
Minimum 873140.81
Maximum 1085677.96
Spread ( max - min ) 212537.15
Range [ ( max - min ) / 2 * 100% ] 10.98%
Damage
Sample Data Alythyss Damage
Count 9999
Mean 237748254.47
Minimum 169632633.62
Maximum 316488709.84
Spread ( max - min ) 146856076.22
Range [ ( max - min ) / 2 * 100% ] 30.88%
DTPS
Sample Data Alythyss Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Alythyss Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Alythyss Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Alythyss Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Alythyss Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Alythyss Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data AlythyssTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Alythyss Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 15.07 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.23 immolate,if=remains<=tick_time
F 0.69 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.37 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 14.06 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 35.28 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
L 14.27 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
M 3.67 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.89 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 12.06 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 60.45 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 78.33 incinerate
0.00 life_tap

Sample Sequence

01269ABCDEGHJKMKNPQKQRRRKSRSSSSKRSLCSSRESSSQGJKRKRKRLRCRKSQRRKRSESQSLRCSSSSSQRGJKKRSSSKLRCKSRSSEQSSMSSSLSGCJKKRFRKRRSSKLRRCERPISQSRSSGJKKQLRRRSKCRSSRKRSSSSRELRSSRSSCSQGJRKRKKRLQRHKMRCSSSRESSQRGJKLRRCKRKRSKRSRSSELSQRCRSGJKKORKRLRSPQKCSRSESSSSSLRGJKCQRJJMRSSJRLSQRECFJSRJR

Sample Sequence Table

time name target resources buffs
Pre flask Alythyss 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Alythyss 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Alythyss 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.090 dimensional_rift Fluffy_Pillow 1032976.4/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.951 immolate Fluffy_Pillow 1049545.8/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.814 immolate Fluffy_Pillow 1000155.3/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.664 berserking Fluffy_Pillow 950751.3/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.664 conflagrate Fluffy_Pillow 950751.3/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:04.420 conflagrate Fluffy_Pillow 967726.0/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:05.174 service_imp Fluffy_Pillow 984655.8/1100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:05.929 conflagrate Fluffy_Pillow 1001608.1/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:06.671 summon_infernal Fluffy_Pillow 1018507.3/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
0:07.424 soul_harvest Fluffy_Pillow 1035657.1/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
0:07.424 dimensional_rift Fluffy_Pillow 1035657.1/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
0:08.179 conflagrate Fluffy_Pillow 1052852.4/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:08.935 dimensional_rift Fluffy_Pillow 1070070.4/1100000: 97% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:09.689 chaos_bolt Fluffy_Pillow 1087243.0/1100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:10.645 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:11.400 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:12.160 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:13.158 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:13.945 chaos_bolt Fluffy_Pillow 1037675.7/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:14.699 incinerate Fluffy_Pillow 1052185.9/1100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:15.452 incinerate Fluffy_Pillow 1000676.9/1100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:16.207 incinerate Fluffy_Pillow 949206.4/1100000: 86% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:16.962 incinerate Fluffy_Pillow 897735.9/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:17.716 conflagrate Fluffy_Pillow 846246.2/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:18.471 chaos_bolt Fluffy_Pillow 860775.7/1100000: 78% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:19.226 incinerate Fluffy_Pillow 875305.2/1100000: 80% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:19.982 life_tap Fluffy_Pillow 823853.9/1100000: 75% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
0:20.995 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
0:21.993 incinerate Fluffy_Pillow 1031527.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3), potion_of_deadly_grace
0:23.176 incinerate Fluffy_Pillow 988958.0/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4), potion_of_deadly_grace
0:24.341 chaos_bolt Fluffy_Pillow 946356.9/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4), potion_of_deadly_grace
0:26.281 immolate Fluffy_Pillow 984731.0/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_deadly_grace
0:27.310 incinerate Fluffy_Pillow 938245.4/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_deadly_grace
0:28.544 incinerate Fluffy_Pillow 895647.6/1100000: 81% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:29.593 incinerate Fluffy_Pillow 849541.3/1100000: 77% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:30.642 dimensional_rift Fluffy_Pillow 803435.1/1100000: 73% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:31.517 immolate Fluffy_Pillow 820029.0/1100000: 75% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:32.390 conflagrate Fluffy_Pillow 770584.9/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:33.258 conflagrate Fluffy_Pillow 787164.2/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
0:34.117 chaos_bolt Fluffy_Pillow 803695.1/1100000: 73% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
0:35.835 conflagrate Fluffy_Pillow 836757.0/1100000: 76% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:36.697 chaos_bolt Fluffy_Pillow 853345.6/1100000: 78% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:37.729 conflagrate Fluffy_Pillow 873205.8/1100000: 79% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:38.589 chaos_bolt Fluffy_Pillow 889755.9/1100000: 81% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:39.620 life_tap Fluffy_Pillow 909596.9/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:40.481 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:41.513 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:42.617 chaos_bolt Fluffy_Pillow 1028580.9/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:43.939 conflagrate Fluffy_Pillow 1048436.0/1100000: 95% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:45.048 incinerate Fluffy_Pillow 1065000.7/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:46.408 dimensional_rift Fluffy_Pillow 1018840.4/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:47.544 chaos_bolt Fluffy_Pillow 1035412.5/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:48.905 chaos_bolt Fluffy_Pillow 1055442.7/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:50.247 conflagrate Fluffy_Pillow 1075308.8/1100000: 98% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:51.365 chaos_bolt Fluffy_Pillow 1091859.0/1100000: 99% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:52.707 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:54.049 immolate Fluffy_Pillow 1034074.0/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:55.166 incinerate Fluffy_Pillow 984609.4/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:56.507 dimensional_rift Fluffy_Pillow 938460.7/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:57.625 incinerate Fluffy_Pillow 955010.8/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
0:58.966 life_tap Fluffy_Pillow 909067.0/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:00.069 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:02.269 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
1:03.024 incinerate Fluffy_Pillow 1023014.0/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
1:03.920 incinerate Fluffy_Pillow 970085.7/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:04.804 incinerate Fluffy_Pillow 917171.9/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:05.688 incinerate Fluffy_Pillow 864258.1/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:06.571 incinerate Fluffy_Pillow 811329.4/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando
1:07.455 dimensional_rift Fluffy_Pillow 758415.6/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando
1:08.209 chaos_bolt Fluffy_Pillow 769577.3/1100000: 70% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando
1:09.678 immolate Fluffy_Pillow 791323.5/1100000: 72% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:10.433 conflagrate Fluffy_Pillow 736505.0/1100000: 67% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:11.187 conflagrate Fluffy_Pillow 747829.3/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:11.943 conflagrate Fluffy_Pillow 759183.6/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:12.698 chaos_bolt Fluffy_Pillow 770522.9/1100000: 70% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:13.569 incinerate Fluffy_Pillow 783604.4/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:14.438 incinerate Fluffy_Pillow 730655.9/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:15.998 incinerate Fluffy_Pillow 688050.2/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:17.601 conflagrate Fluffy_Pillow 645435.7/1100000: 59% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
1:18.908 life_tap Fluffy_Pillow 664934.8/1100000: 60% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(2)
1:20.206 chaos_bolt Fluffy_Pillow 1014429.4/1100000: 92% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(2)
1:22.800 havoc enemy2 1053814.3/1100000: 96% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
1:23.871 conflagrate Fluffy_Pillow 982361.1/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
1:24.943 incinerate Fluffy_Pillow 998923.3/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:26.229 chaos_bolt Fluffy_Pillow 952791.8/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:27.513 incinerate Fluffy_Pillow 972630.1/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
1:28.778 incinerate Fluffy_Pillow 926446.6/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
1:30.045 immolate Fluffy_Pillow 879811.8/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:31.181 dimensional_rift Fluffy_Pillow 830384.9/1100000: 75% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:32.299 incinerate Fluffy_Pillow 846935.0/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:33.641 incinerate Fluffy_Pillow 800802.2/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:34.965 service_imp Fluffy_Pillow 754687.3/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:36.276 incinerate Fluffy_Pillow 774377.2/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:37.600 incinerate Fluffy_Pillow 728263.6/1100000: 66% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:38.905 incinerate Fluffy_Pillow 682144.3/1100000: 62% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:40.208 life_tap Fluffy_Pillow 635994.6/1100000: 58% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
1:41.296 incinerate Fluffy_Pillow 982569.4/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:42.600 immolate Fluffy_Pillow 936434.9/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:43.709 havoc enemy2 886990.9/1100000: 81% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:44.828 conflagrate Fluffy_Pillow 815555.9/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:45.930 conflagrate Fluffy_Pillow 832106.7/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:47.032 conflagrate Fluffy_Pillow 848657.6/1100000: 77% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:48.118 chaos_bolt Fluffy_Pillow 865202.1/1100000: 79% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:50.290 immolate enemy2 898290.9/1100000: 82% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:51.378 chaos_bolt Fluffy_Pillow 848865.8/1100000: 77% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:52.681 conflagrate Fluffy_Pillow 868716.0/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:53.769 chaos_bolt Fluffy_Pillow 885290.9/1100000: 80% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:55.072 chaos_bolt Fluffy_Pillow 905142.0/1100000: 82% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
1:56.355 incinerate Fluffy_Pillow 924525.4/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:57.678 incinerate Fluffy_Pillow 878395.5/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:59.000 conflagrate Fluffy_Pillow 832250.6/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:00.104 life_tap Fluffy_Pillow 848831.5/1100000: 77% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:01.206 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:03.406 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:04.709 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:05.796 immolate Fluffy_Pillow 1028559.6/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:06.882 chaos_bolt Fluffy_Pillow 979104.1/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:08.186 soul_harvest Fluffy_Pillow 998658.7/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:08.186 potion Fluffy_Pillow 998658.7/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos
2:08.186 incinerate Fluffy_Pillow 998658.7/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:09.547 dimensional_rift Fluffy_Pillow 952513.1/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:10.684 incinerate Fluffy_Pillow 969099.7/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:12.047 chaos_bolt Fluffy_Pillow 922983.2/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:13.409 incinerate Fluffy_Pillow 942853.2/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:14.750 incinerate Fluffy_Pillow 896704.5/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:16.092 immolate Fluffy_Pillow 850570.6/1100000: 77% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:16.848 conflagrate Fluffy_Pillow 795762.0/1100000: 72% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:17.603 conflagrate Fluffy_Pillow 806938.5/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando, potion_of_deadly_grace
2:18.358 conflagrate Fluffy_Pillow 818115.0/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando, potion_of_deadly_grace
2:19.112 dimensional_rift Fluffy_Pillow 829276.8/1100000: 75% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando, potion_of_deadly_grace
2:19.866 life_tap Fluffy_Pillow 840438.5/1100000: 76% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando, potion_of_deadly_grace
2:20.620 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando, potion_of_deadly_grace
2:22.091 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:22.962 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:23.818 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:24.677 conflagrate Fluffy_Pillow 1034076.2/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:25.433 havoc enemy2 1045574.5/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:26.188 chaos_bolt Fluffy_Pillow 968588.5/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:27.086 incinerate Fluffy_Pillow 981688.6/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:27.982 incinerate Fluffy_Pillow 928759.5/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, potion_of_deadly_grace
2:29.585 chaos_bolt Fluffy_Pillow 886144.1/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, potion_of_deadly_grace
2:31.188 conflagrate Fluffy_Pillow 909528.8/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, potion_of_deadly_grace
2:32.523 chaos_bolt Fluffy_Pillow 929003.8/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_deadly_grace
2:34.129 incinerate Fluffy_Pillow 952840.7/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:35.686 incinerate Fluffy_Pillow 910232.1/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:36.544 incinerate Fluffy_Pillow 857303.1/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:37.403 incinerate Fluffy_Pillow 804389.3/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:38.262 chaos_bolt Fluffy_Pillow 751475.6/1100000: 68% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
2:39.688 immolate Fluffy_Pillow 773199.6/1100000: 70% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
2:40.442 life_tap Fluffy_Pillow 718695.5/1100000: 65% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
2:41.197 chaos_bolt Fluffy_Pillow 1060360.2/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
2:42.043 incinerate Fluffy_Pillow 1073478.4/1100000: 98% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
2:42.878 incinerate Fluffy_Pillow 1020558.8/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
2:43.712 chaos_bolt Fluffy_Pillow 967623.5/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
2:44.546 incinerate Fluffy_Pillow 980688.3/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
2:45.379 incinerate Fluffy_Pillow 927318.0/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:46.262 havoc enemy2 874390.2/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
2:47.018 incinerate Fluffy_Pillow 797744.5/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
2:47.887 dimensional_rift Fluffy_Pillow 744796.0/1100000: 68% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
2:49.185 immolate Fluffy_Pillow 764290.6/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
2:50.482 conflagrate Fluffy_Pillow 717770.2/1100000: 65% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
2:51.781 chaos_bolt Fluffy_Pillow 737279.8/1100000: 67% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(2)
2:54.374 conflagrate Fluffy_Pillow 776291.4/1100000: 71% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(3)
2:55.654 chaos_bolt Fluffy_Pillow 795791.2/1100000: 72% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:56.956 conflagrate Fluffy_Pillow 815626.9/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
2:58.065 conflagrate Fluffy_Pillow 832167.0/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:59.200 chaos_bolt Fluffy_Pillow 848724.5/1100000: 77% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:00.561 life_tap Fluffy_Pillow 868579.7/1100000: 79% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:01.680 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:02.797 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:04.139 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:04.139 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:05.098 service_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:06.134 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:07.282 havoc enemy2 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:08.240 incinerate Fluffy_Pillow 1028546.4/1100000: 94% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:09.390 incinerate Fluffy_Pillow 982425.3/1100000: 89% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:10.525 incinerate Fluffy_Pillow 936309.8/1100000: 85% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:11.660 chaos_bolt Fluffy_Pillow 890194.4/1100000: 81% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:13.548 immolate Fluffy_Pillow 922534.5/1100000: 84% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:14.593 incinerate Fluffy_Pillow 873072.3/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:15.956 incinerate Fluffy_Pillow 826957.1/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:17.297 dimensional_rift Fluffy_Pillow 780808.4/1100000: 71% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:18.416 chaos_bolt Fluffy_Pillow 797373.4/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:20.648 immolate Fluffy_Pillow 830765.0/1100000: 76% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:21.751 conflagrate Fluffy_Pillow 781330.9/1100000: 71% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:22.853 conflagrate Fluffy_Pillow 797881.8/1100000: 73% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:23.940 life_tap Fluffy_Pillow 814441.5/1100000: 74% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:25.028 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:27.198 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:28.501 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:29.622 conflagrate Fluffy_Pillow 1028594.6/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:30.739 chaos_bolt Fluffy_Pillow 1045129.9/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:32.080 conflagrate Fluffy_Pillow 1064982.1/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:33.183 chaos_bolt Fluffy_Pillow 1081548.0/1100000: 98% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:34.504 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:35.827 conflagrate Fluffy_Pillow 1034076.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:36.914 chaos_bolt Fluffy_Pillow 1050635.8/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:38.219 incinerate Fluffy_Pillow 1070517.8/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
3:39.503 chaos_bolt Fluffy_Pillow 1024355.5/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
3:40.788 incinerate Fluffy_Pillow 1043957.8/1100000: 95% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:42.149 incinerate Fluffy_Pillow 997812.1/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:43.511 immolate Fluffy_Pillow 951770.6/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:44.614 life_tap Fluffy_Pillow 902336.5/1100000: 82% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:45.716 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:47.040 dimensional_rift Fluffy_Pillow 1034090.1/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:48.144 chaos_bolt Fluffy_Pillow 1050671.0/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:50.346 havoc enemy2 1083742.8/1100000: 99% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:51.449 chaos_bolt Fluffy_Pillow 1012308.7/1100000: 92% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:52.773 incinerate Fluffy_Pillow 1032195.1/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:54.077 immolate Fluffy_Pillow 986060.6/1100000: 90% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:55.166 conflagrate Fluffy_Pillow 936608.1/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:56.302 conflagrate Fluffy_Pillow 953180.1/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:57.437 conflagrate Fluffy_Pillow 969737.5/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:58.573 summon_doomguard Fluffy_Pillow 986309.6/1100000: 90% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames
3:59.707 chaos_bolt Fluffy_Pillow 1002852.4/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
4:01.975 conflagrate Fluffy_Pillow 1035939.4/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:03.095 chaos_bolt Fluffy_Pillow 1052519.2/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:04.437 life_tap Fluffy_Pillow 1072386.4/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:05.540 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:06.862 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:08.183 soul_harvest Fluffy_Pillow 1034045.1/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:08.186 dimensional_rift Fluffy_Pillow 1034090.1/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:09.290 conflagrate Fluffy_Pillow 1050671.0/1100000: 96% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:10.393 havoc enemy2 1067237.0/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:11.496 incinerate Fluffy_Pillow 995802.9/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:12.816 chaos_bolt Fluffy_Pillow 949627.9/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2)
4:15.017 incinerate Fluffy_Pillow 982233.0/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos
4:16.378 immolate Fluffy_Pillow 936147.2/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:17.495 incinerate Fluffy_Pillow 886683.2/1100000: 81% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2)
4:18.817 incinerate Fluffy_Pillow 840644.2/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4)
4:20.104 incinerate Fluffy_Pillow 794528.2/1100000: 72% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4)
4:21.390 incinerate Fluffy_Pillow 748396.7/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4)
4:22.676 incinerate Fluffy_Pillow 702265.3/1100000: 64% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4)
4:23.962 life_tap Fluffy_Pillow 656133.8/1100000: 60% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4)
4:25.034 chaos_bolt Fluffy_Pillow 1002696.1/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4)
4:27.174 immolate Fluffy_Pillow 1035759.8/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(5)
4:28.242 conflagrate Fluffy_Pillow 986337.3/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:29.377 conflagrate Fluffy_Pillow 1002894.7/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:30.514 havoc enemy2 1019481.4/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:31.633 dimensional_rift Fluffy_Pillow 948046.3/1100000: 86% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:32.751 chaos_bolt Fluffy_Pillow 964596.5/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:34.983 conflagrate Fluffy_Pillow 997637.6/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:36.101 conflagrate Fluffy_Pillow 1014187.7/1100000: 92% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:37.219 service_imp Fluffy_Pillow 1030737.9/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:38.331 chaos_bolt Fluffy_Pillow 1047267.4/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:39.655 incinerate Fluffy_Pillow 1067152.5/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:40.979 incinerate Fluffy_Pillow 1021037.6/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:42.302 conflagrate Fluffy_Pillow 974908.7/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:43.427 chaos_bolt Fluffy_Pillow 991457.3/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:44.787 life_tap Fluffy_Pillow 1011297.0/1100000: 92% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:45.923 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:47.285 dimensional_rift Fluffy_Pillow 1034072.9/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:48.420 chaos_bolt Fluffy_Pillow 1050630.4/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:49.781 immolate Fluffy_Pillow 1070484.7/1100000: 97% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:50.916 havoc enemy2 1021042.2/1100000: 93% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:52.053 immolate enemy2 949628.8/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:53.190 conflagrate Fluffy_Pillow 900216.7/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:54.308 incinerate Fluffy_Pillow 916766.8/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:55.649 chaos_bolt Fluffy_Pillow 870618.1/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:57.883 conflagrate Fluffy_Pillow 903688.9/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:59.002 chaos_bolt Fluffy_Pillow 920253.8/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52586 52586 34192
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3155160 3155160 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 19.29% 19.29% 5714
Haste 32.62% 31.62% 11857
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14588 14478 0
Mastery 50.43% 50.43% 3523
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Alythess's Pyrogenics
ilevel: 940, stats: { +2658 Sta, +2137 Crit, +1602 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Alythyss"
level=110
race=troll
role=spell
position=back
talents=2303021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=alythesss_pyrogenics,id=132460,ilevel=940,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=34192
# gear_intellect=38456
# gear_crit_rating=5714
# gear_haste_rating=11857
# gear_mastery_rating=3523
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Burning_Wish/Metronome : 981830 dps, 568275 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
981829.7 981829.7 560.7 / 0.057% 109971.7 / 11.2% 33.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
24158.8 24158.8 Mana 0.00% 50.8 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Burning_Wish/Metronome 981830
Chaos Bolt 296029 30.2% 57.0 5.13sec 1562575 1013368 Direct 109.4 0 813810 813810 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.98 109.41 0.00 0.00 1.5420 0.0000 89041619.85 89041619.85 0.00 1013368.16 1013368.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 109.41 100.00% 813809.66 526074 1187922 814166.47 760284 876212 89041620 89041620 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 112665 11.5% 49.1 6.11sec 689596 658085 Direct 98.2 202473 458294 344921 55.7%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.10 98.16 0.00 0.00 1.0479 0.0000 33857178.23 33857178.23 0.00 658085.41 658085.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.50 44.32% 202473.24 131502 296941 202542.33 182594 224668 8808158 8808158 0.00
crit 54.66 55.68% 458294.46 263113 683455 458372.01 406978 502649 25049020 25049020 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 13925 1.4% 33.0 5.00sec 124764 0 Direct 33.0 108437 216919 124762 15.1%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.97 32.97 0.00 0.00 0.0000 0.0000 4113672.53 4113672.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.01 84.95% 108436.76 87244 115162 108436.37 103820 112545 3037252 3037252 0.00
crit 4.96 15.05% 216919.24 174488 230324 215728.78 0 230324 1076420 1076420 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 243885 24.9% 20.2 15.06sec 3633734 3437862 Direct 39.0 138491 276985 204027 47.3%  
Periodic 287.3 154596 309206 227448 47.1% 196.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.17 39.03 287.26 287.26 1.0570 2.0612 73298663.94 73298663.94 0.00 119490.83 3437862.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.56 52.68% 138491.33 91232 206011 138476.07 117991 158657 2847271 2847271 0.00
crit 18.47 47.32% 276984.57 182468 412005 276851.57 234981 324074 5115360 5115360 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 151.9 52.88% 154595.98 97 479012 154779.87 131754 174636 23482681 23482681 0.00
crit 135.4 47.12% 309205.68 145 916025 309596.61 265188 366651 41853352 41853352 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 117311 12.0% 70.0 4.10sec 504793 395543 Direct 134.4 228305 456575 262752 15.1%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.98 134.44 0.00 0.00 1.2762 0.0000 35325195.43 35325195.43 0.00 395543.46 395543.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 114.16 84.91% 228304.99 147497 333020 228277.01 212895 242525 26062452 26062452 0.00
crit 20.29 15.09% 456575.33 294985 666033 456443.80 379458 528404 9262743 9262743 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Kil'jaeden's Burning Wish 16104 1.6% 4.5 75.45sec 1075062 0 Direct 8.9 0 539100 539100 100.0%  

Stats details: kiljaedens_burning_wish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.48 8.94 0.00 0.00 0.0000 0.0000 4821491.72 4821491.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 8.94 100.00% 539100.00 539100 539100 539100.00 539100 539100 4821492 4821492 0.00
 
 

Action details: kiljaedens_burning_wish

Static Values
  • id:235999
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:29.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:235999
  • name:Kil'jaeden's Burning Wish
  • school:fire
  • tooltip:
  • description:{$@spelldesc235991=Launch a vortex of destruction that seeks your current enemy. When it reaches the target, it explodes, dealing a critical strike to all enemies within $235999A1 yds for ${{$235999s1=72632 to 80278}*{$s2=200}/100} Fire damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:269550.00
  • base_dd_max:269550.00
 
Mark of the Hidden Satyr 9881 1.0% 20.3 14.83sec 146208 0 Direct 20.3 126950 253867 146205 15.2%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.32 20.32 0.00 0.00 0.0000 0.0000 2971162.67 2971162.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.24 84.83% 126950.18 111622 147341 126959.45 119994 137896 2188379 2188379 0.00
crit 3.08 15.17% 253867.06 223244 294682 243333.34 0 294682 782784 782784 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 42786 / 42786
Firebolt 42786 4.4% 110.6 2.72sec 116331 94978 Direct 109.7 101852 203673 117230 15.1%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.58 109.73 0.00 0.00 1.2248 0.0000 12863877.25 12863877.25 0.00 94977.72 94977.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.16 84.90% 101851.95 65858 118545 101855.63 99853 103847 9488374 9488374 0.00
crit 16.57 15.10% 203672.50 131717 237090 203672.66 184403 223918 3375503 3375503 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 122246 / 38871
Firebolt 122246 4.0% 49.2 5.52sec 236881 204785 Direct 48.9 207054 414083 238167 15.0%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.20 48.94 0.00 0.00 1.1567 0.0000 11654919.57 11654919.57 0.00 204784.84 204784.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.58 84.97% 207053.50 131717 237090 207207.97 200868 213926 8609506 8609506 0.00
crit 7.35 15.03% 414083.27 263433 474180 414114.11 0 474180 3045413 3045413 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 109493 / 9265
Immolation 84337 0.7% 1.0 0.00sec 2108505 0 Periodic 45.3 40410 80832 46538 15.2% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.65 45.31 0.0000 1.0823 2108504.63 2108504.63 0.00 85998.23 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.4 84.84% 40409.55 34882 41858 40411.83 39655 41322 1553202 1553202 0.00
crit 6.9 15.16% 80832.36 69764 83717 80825.95 0 83717 555303 555303 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25156 0.2% 22.7 1.09sec 27763 25652 Direct 22.7 24167 48321 27764 14.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.65 22.65 0.00 0.00 1.0823 0.0000 628924.28 924578.26 31.98 25651.53 25651.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.28 85.11% 24166.52 20859 25031 24167.80 23541 25031 465931 684963 31.98
crit 3.37 14.89% 48321.12 41719 50063 47042.98 0 50063 162993 239615 31.13
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 96468 / 8152
Doom Bolt 96468 0.8% 11.0 2.21sec 219152 99104 Direct 11.0 190455 380682 219166 15.1%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.01 11.00 0.00 0.00 2.2114 0.0000 2411788.54 2411788.54 0.00 99103.74 99103.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.34 84.91% 190454.71 184178 221013 190457.40 184178 221013 1779516 1779516 0.00
crit 1.66 15.09% 380682.25 368356 442027 318130.72 0 442027 632272 632272 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 109558 / 9271
Immolation 84348 0.7% 1.0 0.00sec 2108792 0 Periodic 45.3 40410 80830 46545 15.2% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.65 45.31 0.0000 1.0823 2108792.09 2108792.09 0.00 86009.96 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.4 84.82% 40409.76 34882 41858 40411.80 39596 41243 1552914 1552914 0.00
crit 6.9 15.18% 80829.99 69764 83717 80822.51 0 83717 555878 555878 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25210 0.2% 22.7 1.09sec 27823 25706 Direct 22.7 24166 48325 27823 15.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.65 22.65 0.00 0.00 1.0823 0.0000 630271.52 926558.83 31.98 25706.48 25706.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.22 84.86% 24166.23 20859 25031 24167.57 23541 25031 464584 682982 31.98
crit 3.43 15.14% 48324.53 41719 50063 47187.94 0 50063 165688 243576 31.23
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 109446 / 9261
Immolation 84252 0.7% 1.0 0.00sec 2106382 0 Periodic 45.3 40408 80848 46492 15.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.65 45.31 0.0000 1.0823 2106382.20 2106382.20 0.00 85911.67 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.5 84.96% 40408.15 34882 41858 40410.16 39533 41435 1555324 1555324 0.00
crit 6.8 15.04% 80848.28 69764 83717 80842.30 0 83717 551058 551058 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25194 0.2% 22.7 1.09sec 27805 25690 Direct 22.7 24165 48338 27805 15.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.65 22.65 0.00 0.00 1.0823 0.0000 629875.15 925976.13 31.98 25690.32 25690.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.24 84.94% 24165.07 20859 25031 24166.17 23541 25031 464980 683565 31.98
crit 3.41 15.06% 48337.62 41719 50063 47174.90 0 50063 164895 242411 31.21
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 109398 / 9258
Immolation 84214 0.7% 1.0 0.00sec 2105438 0 Periodic 45.3 40411 80818 46471 15.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.65 45.31 0.0000 1.0823 2105437.51 2105437.51 0.00 85873.13 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.5 85.00% 40410.81 34882 41858 40412.75 39596 41277 1556269 1556269 0.00
crit 6.8 15.00% 80818.23 69764 83717 80796.43 0 83717 549169 549169 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25183 0.2% 22.7 1.09sec 27793 25680 Direct 22.7 24165 48338 27794 15.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.65 22.65 0.00 0.00 1.0823 0.0000 629610.21 925586.64 31.98 25679.51 25679.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.25 84.99% 24165.07 20859 25031 24166.20 23427 25031 465245 683955 31.98
crit 3.40 15.01% 48337.59 41719 50063 47146.71 0 50063 164365 241632 31.20
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 115458 / 19210
Shadow Bolt 115458 1.9% 4.3 60.67sec 1349743 0 Periodic 45.4 109934 219804 126622 15.2% 19.2%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.26 0.00 45.65 45.40 0.0000 1.2691 5748224.55 5748224.55 0.00 99211.66 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.5 84.81% 109933.69 83 128796 109722.80 0 128796 4232564 4232564 0.00
crit 6.9 15.19% 219804.01 456 257592 216452.21 0 257592 1515660 1515660 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 136535 / 9127
Chaos Bolt 136535 0.9% 4.2 61.27sec 648904 319506 Direct 4.2 0 653251 653251 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.22 4.19 0.00 0.00 2.0311 0.0000 2737205.94 2737205.94 0.00 319505.77 319505.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.19 100.00% 653250.69 617587 741104 653811.67 0 741104 2737206 2737206 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 233640 / 17226
Chaos Barrage 233640 1.7% 4.3 61.23sec 1206326 0 Periodic 144.0 31088 62186 35788 15.1% 7.7%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.27 0.00 144.66 143.96 0.0000 0.1604 5152011.46 5152011.46 0.00 222021.61 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 122.2 84.89% 31088.05 156 35420 31029.03 0 35420 3798939 3798939 0.00
crit 21.8 15.11% 62185.96 312 70840 62055.43 0 70840 1353073 1353073 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Burning_Wish/Metronome
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Burning_Wish/Metronome
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.99sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.7 24.22sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.66 0.00 0.00 0.00 1.0225 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Burning_Wish/Metronome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Burning_Wish/Metronome
  • harmful:false
  • if_expr:
 
Havoc 15.1 20.67sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.05 0.00 0.00 0.00 1.0817 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.3 20.40sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.29 0.00 0.00 0.00 1.0066 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 92.18sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.66 0.00 0.00 0.00 0.9787 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.09sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0992 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7525 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.3sec 15.3sec 78.57% 78.57% 1.3(1.3) 19.3

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.75%
  • accelerando_2:24.81%
  • accelerando_3:14.70%
  • accelerando_4:6.52%
  • accelerando_5:2.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 181.0sec 181.0sec 6.84% 7.61% 0.0(0.0) 2.0

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.80% 0.0(0.0) 1.0

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.5 0.0 12.1sec 12.1sec 49.20% 47.82% 0.0(0.0) 0.6

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.20%

Trigger Attempt Success

  • trigger_pct:49.97%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Embrace Chaos 25.4 32.6 12.1sec 5.1sec 59.43% 67.93% 32.6(32.6) 24.8

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 6.7 8.6 46.2sec 20.4sec 98.18% 96.50% 48.3(48.3) 5.7

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:98.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.87% 97.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 128.2sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 121.1sec 121.1sec 17.74% 17.74% 0.0(0.0) 2.7

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.2 61.0sec
chaos_tear 4.2 61.2sec
chaos_portal 4.2 60.7sec
dimension_ripper 3.5 58.3sec

Resources

Resource Usage Type Count Total Average RPE APR
Burning_Wish/Metronome
chaos_bolt Soul Shard 58.0 116.0 2.0 2.0 767814.6
havoc Mana 15.1 1324583.4 88000.0 87999.9 0.0
immolate Mana 20.2 1331322.2 66000.0 65999.4 55.1
incinerate Mana 70.0 4618654.0 66000.0 66000.0 7.6
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 110.6 4423.2 40.0 40.0 2908.3
pet - service_imp
firebolt Energy 49.2 1968.1 40.0 40.0 5921.9
pet - doomguard
doom_bolt Energy 11.0 385.2 35.0 35.0 6261.5
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.29 3252100.01 (45.35%) 212663.80 1794330.06 35.56%
immolate Soul Shard 63.40 62.68 (52.06%) 0.99 0.72 1.13%
conflagrate Soul Shard 49.10 49.03 (40.72%) 1.00 0.07 0.14%
mp5_regen Mana 464.13 3918342.45 (54.65%) 8442.30 793403.55 16.84%
soulsnatcher Soul Shard 8.69 8.69 (7.22%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1874.76 4257.25 (100.00%) 2.27 22.82 0.53%
pet - service_imp
energy_regen Energy 431.58 1365.21 (100.00%) 3.16 63.71 4.46%
pet - doomguard
energy_regen Energy 11.01 350.10 (100.00%) 31.81 45.64 11.53%
Resource RPS-Gain RPS-Loss
Health 0.00 15804.95
Mana 23813.13 24158.85
Soul Shard 0.40 0.40
Combat End Resource Mean Min Max
Mana 997529.49 657396.61 1100000.00
Soul Shard 1.79 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 15.8%

Statistics & Data Analysis

Fight Length
Sample Data Burning_Wish/Metronome Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Burning_Wish/Metronome Damage Per Second
Count 9999
Mean 981829.68
Minimum 895735.48
Maximum 1104676.10
Spread ( max - min ) 208940.63
Range [ ( max - min ) / 2 * 100% ] 10.64%
Standard Deviation 28606.2626
5th Percentile 936846.78
95th Percentile 1031078.31
( 95th Percentile - 5th Percentile ) 94231.53
Mean Distribution
Standard Deviation 286.0769
95.00% Confidence Intervall ( 981268.98 - 982390.38 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3261
0.1 Scale Factor Error with Delta=300 6985636
0.05 Scale Factor Error with Delta=300 27942542
0.01 Scale Factor Error with Delta=300 698563535
Priority Target DPS
Sample Data Burning_Wish/Metronome Priority Target Damage Per Second
Count 9999
Mean 568274.80
Minimum 512836.09
Maximum 631380.83
Spread ( max - min ) 118544.73
Range [ ( max - min ) / 2 * 100% ] 10.43%
Standard Deviation 17812.8804
5th Percentile 540076.72
95th Percentile 598819.01
( 95th Percentile - 5th Percentile ) 58742.29
Mean Distribution
Standard Deviation 178.1377
95.00% Confidence Intervall ( 567925.66 - 568623.94 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3775
0.1 Scale Factor Error with Delta=300 2708645
0.05 Scale Factor Error with Delta=300 10834578
0.01 Scale Factor Error with Delta=300 270864428
DPS(e)
Sample Data Burning_Wish/Metronome Damage Per Second (Effective)
Count 9999
Mean 981829.68
Minimum 895735.48
Maximum 1104676.10
Spread ( max - min ) 208940.63
Range [ ( max - min ) / 2 * 100% ] 10.64%
Damage
Sample Data Burning_Wish/Metronome Damage
Count 9999
Mean 243428984.37
Minimum 174596103.73
Maximum 318881138.40
Spread ( max - min ) 144285034.67
Range [ ( max - min ) / 2 * 100% ] 29.64%
DTPS
Sample Data Burning_Wish/Metronome Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Burning_Wish/Metronome Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Burning_Wish/Metronome Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Burning_Wish/Metronome Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Burning_Wish/Metronome Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Burning_Wish/Metronome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Burning_Wish/MetronomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Burning_Wish/Metronome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 4.48 use_item,name=kiljaedens_burning_wish
D 15.05 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
E 1.00 dimensional_rift,if=charges=3
F 10.23 immolate,if=remains<=tick_time
G 0.65 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
H 9.33 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
I 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
J 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
K 14.01 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
L 35.09 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
M 14.29 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
N 3.66 service_pet
O 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
P 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
Q 2.89 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
R 11.66 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
S 57.30 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
T 70.30 incinerate
0.00 life_tap

Sample Sequence

01269ABCDEFHIKLNLOQRLRSSTLTTSTLSMDTTTTFSSTTHKSLLSSTLMDSSLSRTTTTTFTTTMDHKLSSLSLSTCTSLMTDSFSSTTRSTTHKNLMDSSLSLSLTSTTTFMTDSTQJTTHKSLSLLRMSDLSTTCTTFTTSTMTTHDKSSLLGSSSLSLMRITDTFNTSTTTHKSLMSSDLSLSLSTTTTFSMSCTDRHKLRSLPLSTSMTLTDQSTFSTTTRTTHKMSDLLRSLSTKNSTTFKMDSKSSTTKS

Sample Sequence Table

time name target resources buffs
Pre flask Burning_Wish/Metronome 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Burning_Wish/Metronome 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Burning_Wish/Metronome 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 use_item_kiljaedens_burning_wish Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.096 dimensional_rift Fluffy_Pillow 1032996.5/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.964 immolate Fluffy_Pillow 1049625.2/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.830 immolate Fluffy_Pillow 1000215.5/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.697 berserking Fluffy_Pillow 950825.0/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.697 conflagrate Fluffy_Pillow 950825.0/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:04.452 conflagrate Fluffy_Pillow 967458.4/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando, potion_of_deadly_grace
0:05.206 service_imp Fluffy_Pillow 984069.8/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, accelerando, potion_of_deadly_grace
0:05.962 conflagrate Fluffy_Pillow 1000725.3/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, accelerando, potion_of_deadly_grace
0:06.705 summon_infernal Fluffy_Pillow 1017333.8/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:07.459 soul_harvest Fluffy_Pillow 1034188.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:07.459 dimensional_rift Fluffy_Pillow 1034188.3/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:08.214 conflagrate Fluffy_Pillow 1051065.1/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:08.968 dimensional_rift Fluffy_Pillow 1067919.5/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:09.724 chaos_bolt Fluffy_Pillow 1084818.6/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:11.206 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:12.083 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:13.000 conflagrate Fluffy_Pillow 1034108.5/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:13.774 incinerate Fluffy_Pillow 1050693.4/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:14.825 incinerate Fluffy_Pillow 1004534.5/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:15.862 chaos_bolt Fluffy_Pillow 958400.8/1100000: 87% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:16.899 incinerate Fluffy_Pillow 978267.0/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:17.937 conflagrate Fluffy_Pillow 932152.4/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:18.803 chaos_bolt Fluffy_Pillow 948742.7/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:19.839 life_tap Fluffy_Pillow 968589.8/1100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:20.705 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:21.569 incinerate Fluffy_Pillow 1028552.0/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:22.606 incinerate Fluffy_Pillow 982418.3/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:23.645 incinerate Fluffy_Pillow 936322.8/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:24.681 incinerate Fluffy_Pillow 890170.8/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:25.703 immolate Fluffy_Pillow 844036.1/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:26.556 chaos_bolt Fluffy_Pillow 794616.5/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:28.256 chaos_bolt Fluffy_Pillow 826857.3/1100000: 75% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:29.309 incinerate Fluffy_Pillow 846735.3/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:30.359 incinerate Fluffy_Pillow 800557.2/1100000: 73% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:31.398 immolate Fluffy_Pillow 754461.8/1100000: 69% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:32.264 conflagrate Fluffy_Pillow 705052.1/1100000: 64% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:33.129 chaos_bolt Fluffy_Pillow 721623.3/1100000: 66% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:34.168 conflagrate Fluffy_Pillow 741527.9/1100000: 67% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:35.032 conflagrate Fluffy_Pillow 758079.9/1100000: 69% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:35.897 chaos_bolt Fluffy_Pillow 774651.1/1100000: 70% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:36.936 chaos_bolt Fluffy_Pillow 794555.6/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:37.974 incinerate Fluffy_Pillow 814441.0/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:39.012 conflagrate Fluffy_Pillow 768327.8/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:39.866 life_tap Fluffy_Pillow 784927.6/1100000: 71% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:40.718 havoc enemy2 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:41.742 chaos_bolt Fluffy_Pillow 1027310.9/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:43.071 chaos_bolt Fluffy_Pillow 1047012.4/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:44.419 conflagrate Fluffy_Pillow 1066877.1/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:45.544 chaos_bolt Fluffy_Pillow 1083455.7/1100000: 98% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:46.891 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:48.014 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:49.362 incinerate Fluffy_Pillow 1034073.7/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:50.709 incinerate Fluffy_Pillow 987924.6/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:52.037 incinerate Fluffy_Pillow 941916.4/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
0:53.348 incinerate Fluffy_Pillow 895800.8/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
0:54.659 immolate Fluffy_Pillow 849537.9/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:55.800 incinerate Fluffy_Pillow 800106.6/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:57.167 incinerate Fluffy_Pillow 753957.0/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:58.535 incinerate Fluffy_Pillow 707822.0/1100000: 64% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:59.901 life_tap Fluffy_Pillow 661657.9/1100000: 60% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:01.042 havoc enemy2 1008226.6/1100000: 92% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:02.165 immolate Fluffy_Pillow 936775.6/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:03.290 conflagrate Fluffy_Pillow 887501.9/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:04.382 conflagrate Fluffy_Pillow 904064.7/1100000: 82% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:05.474 chaos_bolt Fluffy_Pillow 920627.4/1100000: 84% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:07.653 chaos_bolt Fluffy_Pillow 953819.5/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
1:08.945 conflagrate Fluffy_Pillow 973694.3/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
1:10.022 chaos_bolt Fluffy_Pillow 990261.8/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
1:11.314 conflagrate Fluffy_Pillow 1010137.7/1100000: 92% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
1:12.375 chaos_bolt Fluffy_Pillow 1026687.4/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
1:13.650 incinerate Fluffy_Pillow 1045920.4/1100000: 95% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:15.017 use_item_kiljaedens_burning_wish Fluffy_Pillow 999770.8/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:15.017 incinerate Fluffy_Pillow 999770.8/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:16.383 chaos_bolt Fluffy_Pillow 953606.8/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:17.751 conflagrate Fluffy_Pillow 973471.7/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:18.892 life_tap Fluffy_Pillow 990040.4/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:20.032 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:21.400 havoc enemy2 1034074.8/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:22.509 chaos_bolt Fluffy_Pillow 962656.6/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:24.722 immolate Fluffy_Pillow 995745.6/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:25.829 chaos_bolt Fluffy_Pillow 946297.5/1100000: 86% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:27.159 chaos_bolt Fluffy_Pillow 966286.1/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:28.468 incinerate Fluffy_Pillow 986140.2/1100000: 90% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:29.777 incinerate Fluffy_Pillow 940193.1/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
1:31.050 dimensional_rift Fluffy_Pillow 894049.7/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
1:32.160 chaos_bolt Fluffy_Pillow 911363.8/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
1:33.433 incinerate Fluffy_Pillow 929939.7/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:34.799 incinerate Fluffy_Pillow 883775.6/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:36.166 immolate Fluffy_Pillow 837626.1/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:37.307 conflagrate Fluffy_Pillow 788195.8/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:38.430 service_imp Fluffy_Pillow 804744.9/1100000: 73% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:39.554 conflagrate Fluffy_Pillow 821308.7/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:40.677 life_tap Fluffy_Pillow 837857.8/1100000: 76% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando
1:41.800 havoc enemy2 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:42.923 chaos_bolt Fluffy_Pillow 1028549.1/1100000: 94% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:45.167 chaos_bolt Fluffy_Pillow 1061782.0/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:46.476 conflagrate Fluffy_Pillow 1081636.1/1100000: 98% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:47.568 chaos_bolt Fluffy_Pillow 1098198.9/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:48.879 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:50.001 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:51.369 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:52.492 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:53.839 chaos_bolt Fluffy_Pillow 1034058.9/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:55.186 incinerate Fluffy_Pillow 1053909.0/1100000: 96% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:56.533 incinerate Fluffy_Pillow 1007759.0/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:57.880 incinerate Fluffy_Pillow 961644.4/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:59.209 immolate Fluffy_Pillow 915515.7/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:00.317 life_tap Fluffy_Pillow 866082.6/1100000: 79% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:01.425 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:02.753 havoc enemy2 1034059.8/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:03.885 chaos_bolt Fluffy_Pillow 962590.9/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
2:06.161 incinerate Fluffy_Pillow 995866.0/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:07.507 soul_harvest Fluffy_Pillow 949701.3/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:07.507 potion Fluffy_Pillow 949701.3/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
2:07.507 incinerate Fluffy_Pillow 949701.3/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:08.854 incinerate Fluffy_Pillow 903551.4/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:10.202 immolate Fluffy_Pillow 857416.2/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:11.324 conflagrate Fluffy_Pillow 807950.5/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:12.449 chaos_bolt Fluffy_Pillow 824529.0/1100000: 75% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:14.692 conflagrate Fluffy_Pillow 857582.9/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:15.816 chaos_bolt Fluffy_Pillow 874146.8/1100000: 79% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:17.165 conflagrate Fluffy_Pillow 894189.3/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:18.305 conflagrate Fluffy_Pillow 910743.4/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:19.429 dimensional_rift Fluffy_Pillow 927307.2/1100000: 84% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:20.550 life_tap Fluffy_Pillow 943826.8/1100000: 86% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:21.662 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:23.873 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:24.964 conflagrate Fluffy_Pillow 1028547.6/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:26.055 chaos_bolt Fluffy_Pillow 1045095.2/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:27.365 incinerate Fluffy_Pillow 1064964.5/1100000: 97% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:28.675 incinerate Fluffy_Pillow 1018834.9/1100000: 93% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:29.966 use_item_kiljaedens_burning_wish Fluffy_Pillow 972783.2/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:30.017 incinerate Fluffy_Pillow 973578.7/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:31.290 incinerate Fluffy_Pillow 926375.3/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:32.636 immolate Fluffy_Pillow 880210.6/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:33.759 incinerate Fluffy_Pillow 830759.6/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:35.106 incinerate Fluffy_Pillow 784609.7/1100000: 71% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:36.455 chaos_bolt Fluffy_Pillow 738489.2/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:38.698 incinerate Fluffy_Pillow 771543.1/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:40.045 life_tap Fluffy_Pillow 725393.1/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:41.168 incinerate Fluffy_Pillow 1071942.2/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:42.515 incinerate Fluffy_Pillow 1025793.1/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:43.843 immolate Fluffy_Pillow 979409.5/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
2:44.981 havoc enemy2 929934.6/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
2:46.121 conflagrate Fluffy_Pillow 858488.7/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
2:47.244 chaos_bolt Fluffy_Pillow 875037.8/1100000: 80% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:49.487 chaos_bolt Fluffy_Pillow 908092.5/1100000: 83% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:50.816 conflagrate Fluffy_Pillow 927963.9/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:51.923 conflagrate Fluffy_Pillow 944515.8/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:53.032 immolate enemy2 961097.7/1100000: 87% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:54.140 chaos_bolt Fluffy_Pillow 911664.6/1100000: 83% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:55.470 chaos_bolt Fluffy_Pillow 931550.8/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:56.797 chaos_bolt Fluffy_Pillow 951392.9/1100000: 86% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:58.107 conflagrate Fluffy_Pillow 971263.3/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
2:59.247 chaos_bolt Fluffy_Pillow 987829.5/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:00.613 conflagrate Fluffy_Pillow 1007666.0/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:01.736 life_tap Fluffy_Pillow 1024215.1/1100000: 93% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:02.859 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:03.983 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:03.983 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:05.154 havoc enemy2 1034050.8/1100000: 94% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:06.119 incinerate Fluffy_Pillow 962608.0/1100000: 88% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:07.275 immolate Fluffy_Pillow 916526.9/1100000: 83% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:08.225 service_imp Fluffy_Pillow 867097.2/1100000: 79% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:09.380 incinerate Fluffy_Pillow 887243.3/1100000: 81% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:10.520 chaos_bolt Fluffy_Pillow 841127.7/1100000: 76% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:12.416 incinerate Fluffy_Pillow 874198.7/1100000: 79% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:13.555 incinerate Fluffy_Pillow 827363.4/1100000: 75% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:14.744 incinerate Fluffy_Pillow 779561.4/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:16.112 immolate Fluffy_Pillow 733426.3/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:17.253 conflagrate Fluffy_Pillow 684013.5/1100000: 62% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:18.379 chaos_bolt Fluffy_Pillow 700606.8/1100000: 64% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:20.624 conflagrate Fluffy_Pillow 733690.2/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:21.748 life_tap Fluffy_Pillow 750254.0/1100000: 68% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando
3:22.872 chaos_bolt Fluffy_Pillow 1096817.8/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:24.219 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:25.567 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:26.691 conflagrate Fluffy_Pillow 1028563.8/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:27.810 chaos_bolt Fluffy_Pillow 1045109.5/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:29.139 conflagrate Fluffy_Pillow 1064980.9/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:30.276 chaos_bolt Fluffy_Pillow 1081503.5/1100000: 98% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:31.643 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:32.767 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:34.115 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:35.423 incinerate Fluffy_Pillow 1034045.5/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:36.731 incinerate Fluffy_Pillow 987884.4/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:38.041 incinerate Fluffy_Pillow 941916.1/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:39.333 immolate Fluffy_Pillow 895937.5/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(5)
3:40.396 chaos_bolt Fluffy_Pillow 846518.5/1100000: 77% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(5)
3:42.516 life_tap Fluffy_Pillow 879586.9/1100000: 80% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:43.578 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
3:44.852 use_item_kiljaedens_burning_wish Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:45.017 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:46.365 havoc enemy2 1034073.7/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:47.490 dimensional_rift Fluffy_Pillow 962652.2/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:48.614 immolate Fluffy_Pillow 979216.0/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:49.736 conflagrate Fluffy_Pillow 929832.3/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:50.844 conflagrate Fluffy_Pillow 946399.2/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:51.944 dimensional_rift Fluffy_Pillow 962928.5/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:53.036 chaos_bolt Fluffy_Pillow 979491.3/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:55.216 conflagrate Fluffy_Pillow 1012556.2/1100000: 92% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:56.308 summon_doomguard Fluffy_Pillow 1029119.0/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:57.423 conflagrate Fluffy_Pillow 1045658.4/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:58.540 chaos_bolt Fluffy_Pillow 1062209.6/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:59.868 incinerate Fluffy_Pillow 1082066.0/1100000: 98% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:01.195 chaos_bolt Fluffy_Pillow 1034044.9/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:02.521 life_tap Fluffy_Pillow 1053871.3/1100000: 96% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:03.627 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:04.956 conflagrate Fluffy_Pillow 1034075.8/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:06.046 incinerate Fluffy_Pillow 1050608.3/1100000: 96% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:07.354 havoc enemy2 1004534.8/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:08.429 soul_harvest Fluffy_Pillow 933071.5/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:08.429 chaos_bolt Fluffy_Pillow 933071.5/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:10.578 incinerate Fluffy_Pillow 965134.1/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:11.945 immolate Fluffy_Pillow 918984.6/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:13.085 chaos_bolt Fluffy_Pillow 869538.7/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:14.452 incinerate Fluffy_Pillow 889389.1/1100000: 81% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:15.819 incinerate Fluffy_Pillow 843240.4/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:17.165 incinerate Fluffy_Pillow 797075.8/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:18.514 dimensional_rift Fluffy_Pillow 750956.6/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:19.621 incinerate Fluffy_Pillow 767508.5/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:20.950 incinerate Fluffy_Pillow 721379.8/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:22.278 immolate Fluffy_Pillow 675236.2/1100000: 61% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:23.384 conflagrate Fluffy_Pillow 625773.8/1100000: 57% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:24.476 life_tap Fluffy_Pillow 642336.6/1100000: 58% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:25.570 chaos_bolt Fluffy_Pillow 988929.7/1100000: 90% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:27.749 havoc enemy2 1021980.3/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:28.884 conflagrate Fluffy_Pillow 950518.7/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:30.023 conflagrate Fluffy_Pillow 967058.4/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:31.163 dimensional_rift Fluffy_Pillow 983612.5/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:32.305 chaos_bolt Fluffy_Pillow 1000195.7/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:34.581 conflagrate Fluffy_Pillow 1033538.0/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:35.705 chaos_bolt Fluffy_Pillow 1050101.8/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:37.053 incinerate Fluffy_Pillow 1069966.6/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:38.401 conflagrate Fluffy_Pillow 1023831.4/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:39.524 service_imp Fluffy_Pillow 1040380.5/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:40.648 chaos_bolt Fluffy_Pillow 1056944.3/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:41.996 incinerate Fluffy_Pillow 1076809.0/1100000: 98% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:43.346 incinerate Fluffy_Pillow 1030703.3/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:44.692 immolate Fluffy_Pillow 984597.5/1100000: 90% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:45.817 conflagrate Fluffy_Pillow 935163.0/1100000: 85% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:46.952 life_tap Fluffy_Pillow 951707.8/1100000: 87% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:48.075 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:49.200 chaos_bolt Fluffy_Pillow 1028578.5/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:51.443 conflagrate Fluffy_Pillow 1061698.4/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:52.551 chaos_bolt Fluffy_Pillow 1078265.3/1100000: 98% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:53.880 chaos_bolt Fluffy_Pillow 1098136.7/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:55.209 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:56.536 incinerate Fluffy_Pillow 1034045.5/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:57.844 conflagrate Fluffy_Pillow 987884.4/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:58.947 chaos_bolt Fluffy_Pillow 1004427.3/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 51868 51868 33640
Intellect 50648 48942 39288 (4272)
Spirit 1 1 0
Health 3112080 3112080 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50648 48942 0
Crit 15.08% 15.08% 4033
Haste 32.01% 31.01% 11629
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14521 14411 0
Mastery 71.07% 71.07% 6275
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Kil'jaeden's Burning Wish
ilevel: 940, stats: { +2994 StrAgiInt, +456 Crit, +456 Mastery, +456 Haste }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Burning_Wish/Metronome"
level=110
race=troll
role=spell
position=back
talents=2303021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=use_item,name=kiljaedens_burning_wish
actions+=/havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=kiljaedens_burning_wish,id=144259,ilevel=940
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.93
# gear_stamina=33640
# gear_intellect=39288
# gear_crit_rating=4033
# gear_haste_rating=11629
# gear_mastery_rating=6275
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Burning_Wish/Whispers : 994308 dps, 576927 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
994307.6 994307.6 646.1 / 0.065% 126279.0 / 12.7% 32.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
25309.1 25309.1 Mana 0.00% 51.8 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Burning_Wish/Whispers 994308
Chaos Bolt 299366 30.2% 57.4 5.09sec 1567542 1035246 Direct 110.3 0 816282 816282 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.44 110.31 0.00 0.00 1.5142 0.0000 90045662.26 90045662.26 0.00 1035245.60 1035245.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 110.31 100.00% 816281.89 527158 1190358 816595.25 770811 868787 90045662 90045662 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 109825 11.0% 48.2 6.23sec 684152 656565 Direct 96.4 202396 457253 342260 54.9%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.22 96.39 0.00 0.00 1.0420 0.0000 32991721.06 32991721.06 0.00 656564.73 656564.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.49 45.12% 202395.89 131784 297551 202482.10 182218 225502 8801961 8801961 0.00
crit 52.90 54.88% 457253.48 263630 684859 457371.49 416440 507975 24189760 24189760 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 13631 1.3% 32.3 5.10sec 124535 0 Direct 32.3 108191 216392 124534 15.1%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.33 32.33 0.00 0.00 0.0000 0.0000 4025793.42 4025793.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.44 84.89% 108190.64 87244 115162 108192.14 103093 112283 2969124 2969124 0.00
crit 4.88 15.11% 216391.77 174488 230324 215139.49 0 230324 1056669 1056669 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 248309 25.0% 19.8 15.41sec 3768968 3572260 Direct 38.6 138693 277098 203912 47.1%  
Periodic 295.1 153826 307429 226184 47.1% 196.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.80 38.57 295.11 295.11 1.0551 2.0066 74613798.28 74613798.28 0.00 121707.97 3572260.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.40 52.88% 138692.61 91427 206435 138667.64 115654 157597 2828691 2828691 0.00
crit 18.17 47.12% 277097.53 182840 412860 277034.51 227923 327436 5036216 5036216 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 156.1 52.89% 153826.39 77 426545 154023.79 134970 176895 24010961 24010961 0.00
crit 139.0 47.11% 307428.99 141 853085 307839.03 264021 362429 42737931 42737931 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 127235 12.8% 75.6 3.79sec 507013 415468 Direct 145.7 228677 457470 263181 15.1%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.60 145.65 0.00 0.00 1.2203 0.0000 38332326.82 38332326.82 0.00 415468.03 415468.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 123.69 84.92% 228677.00 147791 333703 228627.03 214869 241709 28284307 28284307 0.00
crit 21.96 15.08% 457469.56 295775 667400 457359.50 387467 529156 10048020 10048020 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Kil'jaeden's Burning Wish 16100 1.6% 4.5 75.48sec 1074942 0 Direct 8.9 0 539100 539100 100.0%  

Stats details: kiljaedens_burning_wish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.48 8.94 0.00 0.00 0.0000 0.0000 4820413.41 4820413.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 8.94 100.00% 539100.00 539100 539100 539100.00 539100 539100 4820413 4820413 0.00
 
 

Action details: kiljaedens_burning_wish

Static Values
  • id:235999
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:29.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:235999
  • name:Kil'jaeden's Burning Wish
  • school:fire
  • tooltip:
  • description:{$@spelldesc235991=Launch a vortex of destruction that seeks your current enemy. When it reaches the target, it explodes, dealing a critical strike to all enemies within $235999A1 yds for ${{$235999s1=72632 to 80278}*{$s2=200}/100} Fire damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:269550.00
  • base_dd_max:269550.00
 
Mark of the Hidden Satyr 9659 1.0% 19.9 15.07sec 146231 0 Direct 19.9 127073 254208 146232 15.1%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.86 19.86 0.00 0.00 0.0000 0.0000 2904526.36 2904526.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.87 84.93% 127073.21 111851 147644 127074.60 119681 136707 2143656 2143656 0.00
crit 2.99 15.07% 254208.13 223703 295288 241736.73 0 295288 760870 760870 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 41922 / 41922
Firebolt 41922 4.2% 108.1 2.79sec 116623 92834 Direct 107.3 102123 204269 117526 15.1%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.08 107.25 0.00 0.00 1.2563 0.0000 12604734.84 12604734.84 0.00 92834.09 92834.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.08 84.92% 102122.52 65994 118788 102127.86 99894 104253 9301127 9301127 0.00
crit 16.17 15.08% 204268.64 131987 237577 204301.96 184782 224378 3303608 3303608 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 122259 / 38963
Firebolt 122259 3.9% 49.3 5.52sec 237093 199957 Direct 49.0 207089 414004 238411 15.1%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.28 49.01 0.00 0.00 1.1857 0.0000 11683493.62 11683493.62 0.00 199957.10 199957.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.59 84.86% 207088.56 131987 237577 207241.71 200980 214285 8612431 8612431 0.00
crit 7.42 15.14% 414003.66 263974 475154 414067.75 0 475154 3071063 3071063 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 106249 / 8991
Immolation 81791 0.7% 1.0 0.00sec 2044852 0 Periodic 44.0 40418 80847 46474 15.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.00 44.00 0.0000 1.1124 2044851.86 2044851.86 0.00 83558.84 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.4 85.02% 40418.00 34954 41944 40418.24 39689 41327 1512005 1512005 0.00
crit 6.6 14.98% 80847.10 69907 83889 80817.35 0 83889 532847 532847 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24458 0.2% 22.0 1.12sec 27795 24987 Direct 22.0 24169 48354 27795 15.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1124 0.0000 611483.68 898938.93 31.98 24987.07 24987.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.70 85.01% 24169.41 20902 25083 24169.21 23475 25083 452021 664514 31.98
crit 3.30 14.99% 48354.39 41805 50166 47009.99 0 50166 159462 234425 31.08
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 96561 / 8158
Doom Bolt 96561 0.8% 11.0 2.27sec 219471 96899 Direct 11.0 190864 381974 219489 15.0%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.00 11.00 0.00 0.00 2.2650 0.0000 2414046.05 2414046.05 0.00 96899.05 96899.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.35 85.02% 190864.03 184556 221467 190871.29 184556 221467 1784743 1784743 0.00
crit 1.65 14.98% 381973.53 369112 442934 317081.71 0 442934 629303 629303 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 106292 / 8994
Immolation 81816 0.7% 1.0 0.00sec 2045470 0 Periodic 44.0 40421 80818 46488 15.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.00 44.00 0.0000 1.1124 2045469.90 2045469.90 0.00 83584.09 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.4 84.98% 40420.53 34954 41944 40420.65 39689 41345 1511386 1511386 0.00
crit 6.6 15.02% 80818.35 69907 83889 80734.67 0 83889 534083 534083 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24476 0.2% 22.0 1.12sec 27815 25005 Direct 22.0 24171 48331 27815 15.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1124 0.0000 611931.87 899597.81 31.98 25005.39 25005.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.68 84.92% 24171.50 20902 25083 24171.34 23475 25083 451573 663856 31.98
crit 3.32 15.08% 48330.76 41805 50166 46893.76 0 50166 160359 235742 31.04
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 106332 / 8998
Immolation 81869 0.7% 1.0 0.00sec 2046807 0 Periodic 44.0 40419 80836 46518 15.1% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.00 44.00 0.0000 1.1124 2046807.35 2046807.35 0.00 83638.74 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.4 84.91% 40419.01 34954 41944 40419.08 39614 41493 1510049 1510049 0.00
crit 6.6 15.09% 80835.62 69907 83889 80789.26 0 83889 536758 536758 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24462 0.2% 22.0 1.12sec 27799 24991 Direct 22.0 24174 48305 27800 15.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1124 0.0000 611586.95 899090.75 31.98 24991.29 24991.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.69 84.98% 24173.78 20902 25083 24173.74 23590 25083 451918 664363 31.98
crit 3.31 15.02% 48304.97 41805 50166 46977.97 0 50166 159669 234728 31.09
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 106373 / 9002
Immolation 81894 0.7% 1.0 0.00sec 2047439 0 Periodic 44.0 40422 80798 46533 15.1% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.00 44.00 0.0000 1.1124 2047438.68 2047438.68 0.00 83664.54 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.3 84.87% 40422.40 34954 41944 40422.61 39534 41507 1509418 1509418 0.00
crit 6.7 15.13% 80797.59 69907 83889 80730.59 0 83889 538021 538021 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24479 0.2% 22.0 1.12sec 27818 25008 Direct 22.0 24170 48346 27818 15.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.00 22.00 0.00 0.00 1.1124 0.0000 611989.15 899682.02 31.98 25007.73 25007.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.68 84.91% 24170.11 20902 25083 24170.13 23590 25083 451516 663771 31.98
crit 3.32 15.09% 48346.42 41805 50166 46917.93 0 50166 160473 235911 31.03
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 113374 / 19016
Shadow Bolt 113374 1.9% 4.3 59.91sec 1309816 0 Periodic 45.9 107861 215841 124010 15.0% 19.6%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.35 0.00 46.15 45.90 0.0000 1.2787 5691458.35 5691458.35 0.00 96458.86 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.0 85.04% 107860.68 1420 129061 107699.60 0 129061 4209869 4209869 0.00
crit 6.9 14.96% 215841.45 2840 258121 212541.89 0 258121 1481589 1481589 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 136794 / 9449
Chaos Bolt 136794 0.9% 4.4 58.78sec 650316 311186 Direct 4.3 0 654502 654502 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 4.33 0.00 0.00 2.0900 0.0000 2833034.34 2833034.34 0.00 311185.67 311185.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.33 100.00% 654501.80 618855 742626 654816.19 0 742626 2833034 2833034 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 229578 / 17052
Chaos Barrage 229578 1.7% 4.3 60.13sec 1178279 0 Periodic 143.5 30943 61900 35598 15.0% 7.8%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 0.00 144.15 143.45 0.0000 0.1634 5106707.27 5106707.27 0.00 216808.49 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.9 84.96% 30943.20 313 35493 30899.14 0 35493 3771325 3771325 0.00
crit 21.6 15.04% 61899.70 721 70985 61792.77 0 70985 1335383 1335383 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Burning_Wish/Whispers
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Burning_Wish/Whispers
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.58sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.0 23.61sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.96 0.00 0.00 0.00 1.0066 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Burning_Wish/Whispers
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Burning_Wish/Whispers
  • harmful:false
  • if_expr:
 
Havoc 15.1 20.68sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.05 0.00 0.00 0.00 1.0692 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.1 20.68sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.06 0.00 0.00 0.00 1.0047 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.89sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 0.9782 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.30sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.88 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0835 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7628 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.1 0.0 180.6sec 180.6sec 6.85% 13.53% 0.0(0.0) 2.0

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 23.40% 0.0(0.0) 1.0

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.1 0.0 12.4sec 12.4sec 49.06% 46.96% 0.0(0.0) 0.9

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.06%

Trigger Attempt Success

  • trigger_pct:49.95%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.7sec 69.7sec 8.69% 8.69% 0.0(0.0) 3.2

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.69%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.4 32.1 11.6sec 5.1sec 59.07% 66.98% 32.1(32.1) 25.7

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 9.9 5.1 30.9sec 20.7sec 96.78% 94.63% 53.0(53.0) 9.0

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:96.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.89% 97.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.0sec 69.2sec 13.52% 13.52% 0.0(0.0) 3.3

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.52%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 127.9sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 121.3sec 121.3sec 17.72% 17.72% 0.0(0.0) 2.7

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.3 59.7sec
chaos_tear 4.4 59.2sec
chaos_portal 4.3 60.0sec
dimension_ripper 3.8 54.9sec

Resources

Resource Usage Type Count Total Average RPE APR
Burning_Wish/Whispers
chaos_bolt Soul Shard 58.4 116.9 2.0 2.0 770360.2
havoc Mana 15.1 1324460.3 88000.0 87999.9 0.0
immolate Mana 19.8 1306599.4 66000.0 66000.3 57.1
incinerate Mana 75.6 4989898.2 66000.0 66000.2 7.7
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.1 4323.2 40.0 40.0 2915.6
pet - service_imp
firebolt Energy 49.3 1971.1 40.0 40.0 5927.3
pet - doomguard
doom_bolt Energy 11.0 385.0 35.0 35.0 6270.6
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.06 3649857.83 (48.68%) 242317.73 1320695.01 26.57%
immolate Soul Shard 65.23 64.47 (53.11%) 0.99 0.77 1.18%
conflagrate Soul Shard 48.22 48.15 (39.67%) 1.00 0.08 0.16%
mp5_regen Mana 431.74 3847460.05 (51.32%) 8911.58 751560.15 16.34%
soulsnatcher Soul Shard 8.77 8.77 (7.22%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1866.31 4157.09 (100.00%) 2.23 22.74 0.54%
pet - service_imp
energy_regen Energy 418.98 1334.46 (100.00%) 3.18 63.79 4.56%
pet - doomguard
energy_regen Energy 11.00 349.98 (100.00%) 31.82 45.45 11.49%
Resource RPS-Gain RPS-Loss
Health 0.00 15567.22
Mana 24898.41 25309.13
Soul Shard 0.40 0.41
Combat End Resource Mean Min Max
Mana 976582.53 494721.85 1100000.00
Soul Shard 1.86 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 15.0%

Statistics & Data Analysis

Fight Length
Sample Data Burning_Wish/Whispers Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Burning_Wish/Whispers Damage Per Second
Count 9999
Mean 994307.55
Minimum 894580.69
Maximum 1162269.53
Spread ( max - min ) 267688.84
Range [ ( max - min ) / 2 * 100% ] 13.46%
Standard Deviation 32963.3831
5th Percentile 943535.29
95th Percentile 1051173.80
( 95th Percentile - 5th Percentile ) 107638.52
Mean Distribution
Standard Deviation 329.6503
95.00% Confidence Intervall ( 993661.45 - 994953.65 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4223
0.1 Scale Factor Error with Delta=300 9275712
0.05 Scale Factor Error with Delta=300 37102846
0.01 Scale Factor Error with Delta=300 927571136
Priority Target DPS
Sample Data Burning_Wish/Whispers Priority Target Damage Per Second
Count 9999
Mean 576927.11
Minimum 516777.88
Maximum 671230.77
Spread ( max - min ) 154452.89
Range [ ( max - min ) / 2 * 100% ] 13.39%
Standard Deviation 19493.0619
5th Percentile 546322.71
95th Percentile 610108.69
( 95th Percentile - 5th Percentile ) 63785.98
Mean Distribution
Standard Deviation 194.9404
95.00% Confidence Intervall ( 576545.04 - 577309.19 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4386
0.1 Scale Factor Error with Delta=300 3243724
0.05 Scale Factor Error with Delta=300 12974893
0.01 Scale Factor Error with Delta=300 324372323
DPS(e)
Sample Data Burning_Wish/Whispers Damage Per Second (Effective)
Count 9999
Mean 994307.55
Minimum 894580.69
Maximum 1162269.53
Spread ( max - min ) 267688.84
Range [ ( max - min ) / 2 * 100% ] 13.46%
Damage
Sample Data Burning_Wish/Whispers Damage
Count 9999
Mean 247734241.60
Minimum 176237645.43
Maximum 325223340.73
Spread ( max - min ) 148985695.30
Range [ ( max - min ) / 2 * 100% ] 30.07%
DTPS
Sample Data Burning_Wish/Whispers Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Burning_Wish/Whispers Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Burning_Wish/Whispers Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Burning_Wish/Whispers Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Burning_Wish/Whispers Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Burning_Wish/Whispers Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Burning_Wish/WhispersTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Burning_Wish/Whispers Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 4.48 use_item,name=kiljaedens_burning_wish
D 15.05 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
E 1.00 dimensional_rift,if=charges=3
F 10.17 immolate,if=remains<=tick_time
G 0.51 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
H 9.16 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
I 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
J 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
K 13.86 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
L 34.37 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
M 14.06 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
N 3.67 service_pet
O 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
P 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
Q 2.88 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
R 11.96 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
S 57.76 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
T 75.92 incinerate
0.00 life_tap

Sample Sequence

01269ABCDEFHIKNLOQRRSSLLSTLSTTTLMDTRSFTTTTRSHKSLSLSLMDSSLRSTTSTRFSTTMDSHKSLLSTLSCSTTLMDTTTFSRSNTTRHKLMDSLSLSTTLSTTTFMDSQJSTTTHKSLRSLMSDLSLSSCTTRFSTTMSDTHKSLSSLLSSTMLINDRRTTFTTSTRTTHKLSLMSDTLSTSTLSTTTRFMSCDRTTRHKSLPSLSLMSDLQTTSTTTTTFTSTTTSHDKMRSKKGKNSKSSTDFKMSSKTT

Sample Sequence Table

time name target resources buffs
Pre flask Burning_Wish/Whispers 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Burning_Wish/Whispers 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Burning_Wish/Whispers 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:00.000 use_item_kiljaedens_burning_wish Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:00.755 dimensional_rift Fluffy_Pillow 1022963.5/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:01.392 immolate Fluffy_Pillow 1034988.5/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:02.147 immolate Fluffy_Pillow 983241.0/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:02.903 berserking Fluffy_Pillow 931512.4/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:02.903 conflagrate Fluffy_Pillow 931512.4/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:03.657 service_imp Fluffy_Pillow 947881.1/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:04.413 conflagrate Fluffy_Pillow 964293.2/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, nefarious_pact, potion_of_deadly_grace
0:05.165 summon_infernal Fluffy_Pillow 980618.5/1100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, nefarious_pact, potion_of_deadly_grace
0:05.919 soul_harvest Fluffy_Pillow 996987.2/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, nefarious_pact, potion_of_deadly_grace
0:05.919 dimensional_rift Fluffy_Pillow 996987.2/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, potion_of_deadly_grace
0:06.672 dimensional_rift Fluffy_Pillow 1013334.2/1100000: 92% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, potion_of_deadly_grace
0:07.424 chaos_bolt Fluffy_Pillow 1029659.5/1100000: 94% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, potion_of_deadly_grace
0:08.426 chaos_bolt Fluffy_Pillow 1051412.1/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:09.180 conflagrate Fluffy_Pillow 1067780.8/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:09.935 conflagrate Fluffy_Pillow 1084171.2/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:10.689 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:11.443 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:12.199 conflagrate Fluffy_Pillow 1037408.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, potion_of_deadly_grace
0:13.129 chaos_bolt Fluffy_Pillow 1056957.9/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_deadly_grace
0:14.369 incinerate Fluffy_Pillow 1080366.0/1100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_deadly_grace
0:15.610 incinerate Fluffy_Pillow 1034113.3/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_deadly_grace
0:16.848 incinerate Fluffy_Pillow 991483.6/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_deadly_grace
0:18.088 conflagrate Fluffy_Pillow 948891.8/1100000: 86% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_deadly_grace
0:19.122 life_tap Fluffy_Pillow 968411.1/1100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, devils_due, potion_of_deadly_grace
0:20.155 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
0:21.032 incinerate Fluffy_Pillow 1028555.6/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
0:22.085 dimensional_rift Fluffy_Pillow 982433.6/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
0:22.963 chaos_bolt Fluffy_Pillow 999008.1/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
0:24.714 immolate Fluffy_Pillow 1032062.6/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:25.593 incinerate Fluffy_Pillow 982656.0/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:26.645 incinerate Fluffy_Pillow 936515.1/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:27.698 incinerate Fluffy_Pillow 890393.2/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:28.749 incinerate Fluffy_Pillow 844233.5/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames
0:29.802 dimensional_rift Fluffy_Pillow 798111.5/1100000: 73% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames
0:30.682 chaos_bolt Fluffy_Pillow 814723.7/1100000: 74% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames
0:32.435 immolate Fluffy_Pillow 847816.0/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:33.315 conflagrate Fluffy_Pillow 798428.2/1100000: 73% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:34.194 chaos_bolt Fluffy_Pillow 815021.6/1100000: 74% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:35.248 conflagrate Fluffy_Pillow 834918.5/1100000: 76% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:36.126 chaos_bolt Fluffy_Pillow 851493.0/1100000: 77% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:37.179 conflagrate Fluffy_Pillow 871371.0/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:38.058 chaos_bolt Fluffy_Pillow 887964.3/1100000: 81% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:39.110 conflagrate Fluffy_Pillow 907823.5/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:39.987 life_tap Fluffy_Pillow 924379.1/1100000: 84% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:40.866 havoc enemy2 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:41.968 chaos_bolt Fluffy_Pillow 1028002.3/1100000: 93% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:43.334 chaos_bolt Fluffy_Pillow 1047838.3/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:44.700 conflagrate Fluffy_Pillow 1067674.2/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:45.840 dimensional_rift Fluffy_Pillow 1084228.3/1100000: 99% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:46.980 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:48.349 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:49.717 incinerate Fluffy_Pillow 1034072.6/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:51.084 chaos_bolt Fluffy_Pillow 987923.0/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:52.452 incinerate Fluffy_Pillow 1007788.0/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:53.819 dimensional_rift Fluffy_Pillow 961638.5/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:54.959 immolate Fluffy_Pillow 978192.6/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:56.100 chaos_bolt Fluffy_Pillow 928761.3/1100000: 84% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:57.468 incinerate Fluffy_Pillow 948626.2/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:58.835 incinerate Fluffy_Pillow 902476.7/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:00.204 life_tap Fluffy_Pillow 856356.2/1100000: 78% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:01.345 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:02.485 chaos_bolt Fluffy_Pillow 1028554.1/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
1:04.762 immolate Fluffy_Pillow 1061618.8/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:05.902 conflagrate Fluffy_Pillow 1012173.0/1100000: 92% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:07.042 chaos_bolt Fluffy_Pillow 1028727.1/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:08.409 conflagrate Fluffy_Pillow 1048577.6/1100000: 95% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:09.550 conflagrate Fluffy_Pillow 1065146.2/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:10.690 chaos_bolt Fluffy_Pillow 1081700.4/1100000: 98% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:12.058 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:13.424 conflagrate Fluffy_Pillow 1034043.6/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:14.564 chaos_bolt Fluffy_Pillow 1050597.7/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:15.931 use_item_kiljaedens_burning_wish Fluffy_Pillow 1070448.1/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:15.931 chaos_bolt Fluffy_Pillow 1070448.1/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:17.299 incinerate Fluffy_Pillow 1090313.1/1100000: 99% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:18.667 incinerate Fluffy_Pillow 1034072.6/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:20.034 conflagrate Fluffy_Pillow 987923.0/1100000: 90% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:21.175 life_tap Fluffy_Pillow 1004491.7/1100000: 91% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
1:22.318 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
1:23.458 incinerate Fluffy_Pillow 1028554.1/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
1:24.824 incinerate Fluffy_Pillow 982390.1/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
1:26.192 incinerate Fluffy_Pillow 936255.0/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
1:27.559 immolate Fluffy_Pillow 890105.5/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
1:28.699 chaos_bolt Fluffy_Pillow 840659.6/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
1:30.976 dimensional_rift Fluffy_Pillow 873724.3/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:32.117 chaos_bolt Fluffy_Pillow 890293.0/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:33.483 service_imp Fluffy_Pillow 910128.9/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:34.798 incinerate Fluffy_Pillow 929224.2/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:36.165 incinerate Fluffy_Pillow 883074.7/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:37.531 dimensional_rift Fluffy_Pillow 836910.6/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
1:38.672 immolate Fluffy_Pillow 853479.3/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
1:39.812 conflagrate Fluffy_Pillow 804033.4/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
1:40.952 conflagrate Fluffy_Pillow 820587.5/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:42.092 life_tap Fluffy_Pillow 837141.7/1100000: 76% mana | 3.0/5: 60% soul_shard lord_of_flames
1:43.235 havoc enemy2 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames
1:44.378 chaos_bolt Fluffy_Pillow 1028597.7/1100000: 94% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames
1:46.655 conflagrate Fluffy_Pillow 1061662.4/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:47.795 chaos_bolt Fluffy_Pillow 1078216.6/1100000: 98% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:49.162 conflagrate Fluffy_Pillow 1098067.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:50.302 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:51.670 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:53.036 incinerate Fluffy_Pillow 1034043.6/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:54.405 conflagrate Fluffy_Pillow 987923.0/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:55.548 chaos_bolt Fluffy_Pillow 1004520.8/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:56.918 incinerate Fluffy_Pillow 1024414.8/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:58.285 incinerate Fluffy_Pillow 978265.2/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:59.651 incinerate Fluffy_Pillow 932101.1/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:01.017 immolate Fluffy_Pillow 885937.0/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
2:02.156 life_tap Fluffy_Pillow 836476.7/1100000: 76% mana | 2.0/5: 40% soul_shard lord_of_flames
2:03.296 havoc enemy2 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
2:04.436 chaos_bolt Fluffy_Pillow 1028554.1/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
2:06.713 soul_harvest Fluffy_Pillow 1061618.8/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:06.713 potion Fluffy_Pillow 1061618.8/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos
2:06.713 chaos_bolt Fluffy_Pillow 1061618.8/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:08.081 incinerate Fluffy_Pillow 1081483.8/1100000: 98% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:09.450 incinerate Fluffy_Pillow 1034087.1/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:10.817 incinerate Fluffy_Pillow 987937.6/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:12.186 immolate Fluffy_Pillow 941817.1/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
2:13.327 conflagrate Fluffy_Pillow 892385.7/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
2:14.467 chaos_bolt Fluffy_Pillow 908939.9/1100000: 83% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
2:16.742 conflagrate Fluffy_Pillow 941975.5/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:17.882 dimensional_rift Fluffy_Pillow 958529.7/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:19.023 chaos_bolt Fluffy_Pillow 975098.3/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:20.391 conflagrate Fluffy_Pillow 994963.3/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:21.530 life_tap Fluffy_Pillow 1011502.9/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:22.670 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:24.038 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:25.177 conflagrate Fluffy_Pillow 1028539.6/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:26.319 chaos_bolt Fluffy_Pillow 1045122.8/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:27.685 conflagrate Fluffy_Pillow 1064958.7/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:28.847 chaos_bolt Fluffy_Pillow 1081832.3/1100000: 98% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:30.213 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:31.580 use_item_kiljaedens_burning_wish Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:31.580 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:32.948 incinerate Fluffy_Pillow 1034072.6/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:34.315 dimensional_rift Fluffy_Pillow 987923.0/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:35.454 immolate Fluffy_Pillow 1004462.7/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:36.595 chaos_bolt Fluffy_Pillow 955031.3/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:38.870 incinerate Fluffy_Pillow 988067.0/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:40.240 incinerate Fluffy_Pillow 941961.0/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:41.606 life_tap Fluffy_Pillow 895796.9/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:42.744 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:44.110 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:45.250 incinerate Fluffy_Pillow 1028554.1/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:46.619 immolate Fluffy_Pillow 982433.6/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:47.760 conflagrate Fluffy_Pillow 933002.3/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:48.900 chaos_bolt Fluffy_Pillow 949556.4/1100000: 86% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
2:51.176 conflagrate Fluffy_Pillow 982606.6/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:52.317 chaos_bolt Fluffy_Pillow 999175.3/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:53.685 chaos_bolt Fluffy_Pillow 1019040.2/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:55.053 conflagrate Fluffy_Pillow 1038905.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:56.194 conflagrate Fluffy_Pillow 1055473.9/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:57.334 chaos_bolt Fluffy_Pillow 1072028.0/1100000: 97% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:58.702 chaos_bolt Fluffy_Pillow 1091893.0/1100000: 99% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:00.071 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:01.439 life_tap Fluffy_Pillow 1034072.6/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:02.579 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:03.717 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:03.717 service_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos
3:04.709 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames
3:05.702 dimensional_rift Fluffy_Pillow 1028582.5/1100000: 94% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames
3:06.694 dimensional_rift Fluffy_Pillow 1045148.2/1100000: 95% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames
3:07.687 incinerate Fluffy_Pillow 1061730.7/1100000: 97% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames
3:08.877 incinerate Fluffy_Pillow 1015602.9/1100000: 92% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames
3:10.068 immolate Fluffy_Pillow 969491.8/1100000: 88% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames
3:11.062 incinerate Fluffy_Pillow 920091.0/1100000: 84% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames
3:12.250 incinerate Fluffy_Pillow 873929.8/1100000: 79% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames
3:13.440 chaos_bolt Fluffy_Pillow 827802.0/1100000: 75% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames
3:15.421 incinerate Fluffy_Pillow 857171.8/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
3:16.321 dimensional_rift Fluffy_Pillow 804240.9/1100000: 73% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
3:17.077 incinerate Fluffy_Pillow 815218.9/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
3:17.980 incinerate Fluffy_Pillow 762331.5/1100000: 69% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
3:18.881 immolate Fluffy_Pillow 709415.1/1100000: 64% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
3:19.634 conflagrate Fluffy_Pillow 654349.5/1100000: 59% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact
3:20.388 conflagrate Fluffy_Pillow 665298.5/1100000: 60% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact
3:21.142 chaos_bolt Fluffy_Pillow 676247.5/1100000: 61% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact
3:22.640 conflagrate Fluffy_Pillow 698000.2/1100000: 63% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
3:23.395 life_tap Fluffy_Pillow 708963.7/1100000: 64% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:24.147 chaos_bolt Fluffy_Pillow 1049883.6/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:25.047 havoc enemy2 1062952.6/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:25.803 incinerate Fluffy_Pillow 985930.6/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:26.705 conflagrate Fluffy_Pillow 933028.7/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:27.460 chaos_bolt Fluffy_Pillow 943992.2/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:29.069 incinerate Fluffy_Pillow 967356.8/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:30.681 chaos_bolt Fluffy_Pillow 924764.9/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:32.291 incinerate Fluffy_Pillow 948144.0/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:33.901 conflagrate Fluffy_Pillow 905523.1/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:35.244 chaos_bolt Fluffy_Pillow 925025.0/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:36.612 incinerate Fluffy_Pillow 944890.0/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:37.981 incinerate Fluffy_Pillow 898769.5/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:39.349 incinerate Fluffy_Pillow 852634.5/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:40.716 dimensional_rift Fluffy_Pillow 806484.9/1100000: 73% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames
3:41.856 immolate Fluffy_Pillow 823039.0/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
3:42.995 life_tap Fluffy_Pillow 773578.7/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
3:44.137 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
3:46.415 use_item_kiljaedens_burning_wish Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:46.580 havoc enemy2 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:47.722 dimensional_rift Fluffy_Pillow 1028583.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:48.861 incinerate Fluffy_Pillow 1045122.8/1100000: 95% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:50.228 incinerate Fluffy_Pillow 998973.2/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:51.593 dimensional_rift Fluffy_Pillow 952794.6/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
3:52.733 immolate Fluffy_Pillow 969348.8/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
3:53.871 conflagrate Fluffy_Pillow 919873.9/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
3:55.012 chaos_bolt Fluffy_Pillow 936442.5/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:57.288 conflagrate Fluffy_Pillow 969492.7/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:58.428 summon_doomguard Fluffy_Pillow 986046.9/1100000: 90% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:59.568 chaos_bolt Fluffy_Pillow 1002601.0/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:00.934 conflagrate Fluffy_Pillow 1022436.9/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:02.075 chaos_bolt Fluffy_Pillow 1039005.6/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:03.443 conflagrate Fluffy_Pillow 1058870.5/1100000: 96% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:04.583 life_tap Fluffy_Pillow 1075424.7/1100000: 98% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:05.725 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:07.092 havoc enemy2 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
4:07.848 conflagrate Fluffy_Pillow 1022978.0/1100000: 93% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
4:08.604 soul_harvest Fluffy_Pillow 1033956.0/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:08.604 incinerate Fluffy_Pillow 1033956.0/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:09.504 incinerate Fluffy_Pillow 981025.1/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:10.406 chaos_bolt Fluffy_Pillow 928123.2/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:11.305 incinerate Fluffy_Pillow 941177.7/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:12.205 incinerate Fluffy_Pillow 888246.8/1100000: 81% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:13.105 incinerate Fluffy_Pillow 835315.8/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:14.006 incinerate Fluffy_Pillow 782399.4/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:14.905 incinerate Fluffy_Pillow 729453.9/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:15.804 immolate Fluffy_Pillow 676508.5/1100000: 62% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact
4:16.558 incinerate Fluffy_Pillow 621457.4/1100000: 56% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact
4:17.458 chaos_bolt Fluffy_Pillow 568526.5/1100000: 52% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact
4:18.954 incinerate Fluffy_Pillow 590250.2/1100000: 54% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:19.854 incinerate Fluffy_Pillow 537319.2/1100000: 49% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
4:21.464 incinerate Fluffy_Pillow 494698.3/1100000: 45% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
4:23.075 chaos_bolt Fluffy_Pillow 452091.9/1100000: 41% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due
4:25.756 immolate Fluffy_Pillow 491023.2/1100000: 45% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
4:27.099 havoc enemy2 444525.1/1100000: 40% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:28.239 conflagrate Fluffy_Pillow 373079.3/1100000: 34% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:29.379 life_tap Fluffy_Pillow 389633.4/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:30.521 dimensional_rift Fluffy_Pillow 736216.6/1100000: 67% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:31.897 chaos_bolt Fluffy_Pillow 756197.7/1100000: 69% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:34.175 conflagrate Fluffy_Pillow 789276.9/1100000: 72% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:35.315 conflagrate Fluffy_Pillow 805831.1/1100000: 73% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:36.456 immolate enemy2 822399.7/1100000: 75% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:37.597 conflagrate Fluffy_Pillow 772968.4/1100000: 70% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:38.737 service_imp Fluffy_Pillow 789522.5/1100000: 72% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames
4:39.877 chaos_bolt Fluffy_Pillow 806076.7/1100000: 73% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames
4:42.156 conflagrate Fluffy_Pillow 839170.4/1100000: 76% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:43.296 chaos_bolt Fluffy_Pillow 855724.6/1100000: 78% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:44.664 chaos_bolt Fluffy_Pillow 875589.5/1100000: 80% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:46.031 incinerate Fluffy_Pillow 895440.0/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:47.399 havoc enemy2 849304.9/1100000: 77% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:48.539 immolate Fluffy_Pillow 777859.1/1100000: 71% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:49.678 conflagrate Fluffy_Pillow 728398.7/1100000: 66% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:50.819 life_tap Fluffy_Pillow 744967.3/1100000: 68% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos
4:51.959 chaos_bolt Fluffy_Pillow 1091521.5/1100000: 99% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:54.236 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:55.602 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:56.741 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:58.109 incinerate Fluffy_Pillow 1034072.6/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 51868 51868 33640
Intellect 50752 49046 39387 (4272)
Spirit 1 1 0
Health 3112080 3112080 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50752 49046 0
Crit 15.08% 15.08% 4033
Haste 32.01% 31.01% 11629
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14521 14411 0
Mastery 71.07% 71.07% 6275
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Kil'jaeden's Burning Wish
ilevel: 940, stats: { +2994 StrAgiInt, +456 Crit, +456 Mastery, +456 Haste }
Local Trinket2 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Burning_Wish/Whispers"
level=110
race=troll
role=spell
position=back
talents=2303021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=use_item,name=kiljaedens_burning_wish
actions+=/havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=kiljaedens_burning_wish,id=144259,ilevel=940
trinket2=whispers_in_the_dark,id=140809,ilevel=905
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=907.27
# gear_stamina=33640
# gear_intellect=39387
# gear_crit_rating=4033
# gear_haste_rating=11629
# gear_mastery_rating=6275
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Feretory_BD : 949839 dps, 556236 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
949839.1 949839.1 621.5 / 0.065% 122872.5 / 12.9% 25.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
30010.3 30010.3 Mana 0.00% 56.9 100.0% 100%
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Feretory_BD 949839
Chaos Bolt 346161 36.5% 67.3 4.36sec 1545746 1298376 Direct 130.0 0 800511 800511 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.35 130.05 0.00 0.00 1.1905 0.0000 104102476.81 104102476.81 0.00 1298375.84 1298375.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 130.05 100.00% 800510.81 519796 1175195 800568.33 756828 843211 104102477 104102477 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 111712 11.8% 49.0 6.14sec 684998 667616 Direct 97.3 202746 456553 345017 56.1%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.01 97.31 0.00 0.00 1.0261 0.0000 33575052.05 33575052.05 0.00 667615.52 667615.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.77 43.95% 202745.86 131232 296699 202782.46 179935 229366 8670451 8670451 0.00
crit 54.55 56.05% 456553.41 262487 676128 456573.61 413358 503819 24904601 24904601 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 12704 1.3% 33.4 4.87sec 112499 0 Direct 33.4 98714 197427 112497 14.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.38 33.38 0.00 0.00 0.0000 0.0000 3754746.24 3754746.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.72 86.04% 98714.02 87244 104693 98708.64 94805 102417 2834587 2834587 0.00
crit 4.66 13.96% 197426.71 174488 209385 196025.85 0 209385 920159 920159 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 132672 14.0% 18.0 17.01sec 2214877 2116052 Direct 34.4 139853 279774 204245 46.0%  
Periodic 297.1 75845 151660 110683 46.0% 197.1%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.02 34.43 297.08 297.08 1.0467 1.9973 39912968.39 39912968.39 0.00 65194.47 2116051.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.58 53.98% 139853.28 91053 205842 139889.94 116033 159419 2598915 2598915 0.00
crit 15.84 46.02% 279773.76 182103 411678 279839.05 229491 326599 4432668 4432668 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 160.6 54.05% 75844.57 22 111497 75858.57 71842 79802 12178025 12178025 0.00
crit 136.5 45.95% 151660.47 51 222994 151690.15 142843 161411 20703360 20703360 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 162739 17.2% 99.0 2.97sec 494725 470777 Direct 190.0 226330 452689 257855 13.9%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.01 189.97 0.00 0.00 1.0509 0.0000 48984862.51 48984862.51 0.00 470777.43 470777.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 163.52 86.07% 226329.59 147179 332747 226365.11 213514 239575 37008401 37008401 0.00
crit 26.46 13.93% 452689.37 294354 665494 452777.10 385082 533114 11976461 11976461 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 8867 0.9% 20.3 14.80sec 131571 0 Direct 20.3 115499 230948 131568 13.9%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.28 20.28 0.00 0.00 0.0000 0.0000 2667607.69 2667607.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.45 86.08% 115499.27 111395 133674 115501.97 111395 125466 2015765 2015765 0.00
crit 2.82 13.92% 230948.28 222790 267348 217208.11 0 267348 651843 651843 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 42133 / 42133
Firebolt 42133 4.4% 109.9 2.74sec 115225 93461 Direct 109.1 101945 203897 116121 13.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.94 109.09 0.00 0.00 1.2329 0.0000 12667447.63 12667447.63 0.00 93461.18 93461.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.92 86.09% 101944.60 65724 118304 101955.72 99835 104026 9574562 9574562 0.00
crit 15.17 13.91% 203897.35 131449 236608 203944.55 175265 227845 3092886 3092886 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 120729 / 38853
Firebolt 120729 4.1% 49.8 5.49sec 234045 202245 Direct 49.5 206751 413570 235573 13.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.78 49.46 0.00 0.00 1.1572 0.0000 11651551.31 11651551.31 0.00 202245.25 202245.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.57 86.06% 206751.03 131449 236608 206893.72 200317 211961 8800816 8800816 0.00
crit 6.89 13.94% 413569.85 262898 473216 413452.44 0 473216 2850735 2850735 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 108055 / 9144
Immolation 83185 0.7% 1.0 0.00sec 2079707 0 Periodic 45.2 40359 80685 46016 14.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.60 45.20 0.0000 1.0835 2079706.61 2079706.61 0.00 84941.46 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.9 85.97% 40358.99 34811 41773 40361.71 39597 41338 1568144 1568144 0.00
crit 6.3 14.03% 80685.37 69622 83546 80601.11 0 83546 511562 511562 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24870 0.2% 22.6 1.09sec 27515 25395 Direct 22.6 24133 48267 27515 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.60 22.60 0.00 0.00 1.0835 0.0000 621774.69 914067.69 31.98 25395.14 25395.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.43 85.99% 24133.44 20817 24980 24135.07 23494 24761 468938 689383 31.98
crit 3.17 14.01% 48266.68 41634 49961 46765.05 0 49961 152837 224684 30.97
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 95307 / 8055
Doom Bolt 95307 0.8% 11.0 2.23sec 216602 97351 Direct 11.0 189954 379836 216616 14.0%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.00 11.00 0.00 0.00 2.2250 0.0000 2382770.13 2382770.13 0.00 97351.29 97351.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.46 85.96% 189953.84 183803 220564 189947.02 183803 220564 1796173 1796173 0.00
crit 1.54 14.04% 379835.56 367607 441128 305900.47 0 441128 586597 586597 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 107972 / 9137
Immolation 83098 0.7% 1.0 0.00sec 2077533 0 Periodic 45.2 40357 80708 45968 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.60 45.20 0.0000 1.0835 2077533.49 2077533.49 0.00 84852.70 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.9 86.09% 40357.15 34811 41773 40359.77 39663 41351 1570317 1570317 0.00
crit 6.3 13.91% 80707.79 69622 83546 80664.33 0 83546 507216 507216 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24874 0.2% 22.6 1.09sec 27520 25399 Direct 22.6 24133 48277 27520 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.60 22.60 0.00 0.00 1.0835 0.0000 621873.79 914213.37 31.98 25399.19 25399.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.43 85.97% 24132.58 20817 24980 24134.08 23593 24980 468839 689238 31.98
crit 3.17 14.03% 48277.16 41634 49961 46820.23 0 49961 153035 224976 31.01
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 107883 / 9130
Immolation 83072 0.7% 1.0 0.00sec 2076889 0 Periodic 45.2 40357 80713 45953 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.60 45.20 0.0000 1.0835 2076889.42 2076889.42 0.00 84826.39 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.9 86.13% 40356.71 34811 41773 40359.58 39725 41351 1570961 1570961 0.00
crit 6.3 13.87% 80713.23 69622 83546 80580.41 0 83546 505928 505928 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24811 0.2% 22.6 1.09sec 27450 25335 Direct 22.6 24135 48248 27450 13.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.60 22.60 0.00 0.00 1.0835 0.0000 620300.28 911900.16 31.98 25334.92 25334.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.49 86.25% 24134.95 20817 24980 24136.76 23593 24980 470412 691551 31.98
crit 3.11 13.75% 48247.73 41634 49961 46634.73 0 49961 149888 220349 30.91
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 108017 / 9140
Immolation 83152 0.7% 1.0 0.00sec 2078885 0 Periodic 45.2 40358 80700 45998 14.0% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.60 45.20 0.0000 1.0835 2078884.99 2078884.99 0.00 84907.90 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.9 86.02% 40357.82 34811 41773 40360.85 39663 41209 1568966 1568966 0.00
crit 6.3 13.98% 80699.61 69622 83546 80613.83 0 83546 509919 509919 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24864 0.2% 22.6 1.09sec 27509 25389 Direct 22.6 24134 48258 27509 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.60 22.60 0.00 0.00 1.0835 0.0000 621635.62 913863.24 31.98 25389.46 25389.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.44 86.01% 24134.15 20817 24980 24135.67 23494 24980 469077 689588 31.98
crit 3.16 13.99% 48257.88 41634 49961 46559.13 0 49961 152559 224276 30.85
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 115123 / 20710
Shadow Bolt 115123 2.2% 4.7 55.38sec 1314661 0 Periodic 50.1 108586 217582 123799 14.0% 21.3%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.72 0.00 50.40 50.11 0.0000 1.2741 6203916.81 6203916.81 0.00 96614.65 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.1 86.04% 108585.50 70 128534 108459.17 0 128534 4682141 4682141 0.00
crit 7.0 13.96% 217581.77 222 257068 213953.48 0 257068 1521776 1521776 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 142104 / 10047
Chaos Bolt 142104 1.1% 4.7 56.10sec 639402 310623 Direct 4.7 0 643587 643587 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.71 4.68 0.00 0.00 2.0585 0.0000 3010556.27 3010556.27 0.00 310622.81 310622.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.68 100.00% 643587.05 610226 732271 644139.59 0 732271 3010556 3010556 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 247033 / 18873
Chaos Barrage 247033 2.0% 4.7 56.16sec 1193695 0 Periodic 159.1 31168 62339 35504 13.9% 8.5%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.73 0.00 159.80 159.06 0.0000 0.1608 5647175.54 5647175.54 0.00 219734.46 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 136.9 86.09% 31167.52 155 35348 31134.07 0 35348 4267767 4267767 0.00
crit 22.1 13.91% 62339.32 310 70696 62221.02 0 70696 1379409 1379409 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Feretory_BD
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Feretory_BD
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.40sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 14.1 21.55sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.12 0.00 0.00 0.00 0.9983 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Feretory_BD
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Feretory_BD
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.91sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.91 0.00 0.00 0.00 1.0501 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 10.6 22.81sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.64 0.00 0.00 0.00 1.0370 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 90.98sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.73 0.00 0.00 0.00 0.9623 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.70sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0695 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7528 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.38% 78.38% 1.6(1.6) 19.3

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.52%
  • accelerando_2:24.40%
  • accelerando_3:14.65%
  • accelerando_4:6.69%
  • accelerando_5:3.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Backdraft 49.0 0.0 6.1sec 6.1sec 58.62% 44.68% 0.0(0.0) 1.2

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:20.04%
  • backdraft_2:38.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Berserking 2.1 0.0 180.4sec 180.4sec 6.87% 7.45% 0.0(0.0) 2.0

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.57% 0.0(0.0) 1.0

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.5 0.0 12.1sec 12.1sec 51.30% 48.94% 0.0(0.0) 0.0

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:51.30%

Trigger Attempt Success

  • trigger_pct:50.01%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 68.8sec 68.8sec 8.76% 8.76% 0.0(0.0) 3.3

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.76%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 32.6 35.7 9.4sec 4.4sec 69.16% 70.47% 35.7(35.7) 31.9

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:69.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 98.55% 98.55% 0.0(0.0) 0.0

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:98.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.1sec 68.4sec 13.61% 13.61% 0.0(0.0) 3.3

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.61%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 125.9sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 120.7sec 120.7sec 17.96% 17.96% 0.0(0.0) 2.8

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.7 56.0sec
chaos_tear 4.7 56.0sec
chaos_portal 4.7 56.1sec
dimension_ripper 4.9 47.3sec

Resources

Resource Usage Type Count Total Average RPE APR
Feretory_BD
chaos_bolt Soul Shard 68.3 136.7 2.0 2.0 761573.2
havoc Mana 14.9 1312231.9 88000.0 88000.2 0.0
immolate Mana 18.0 1189339.4 66000.0 65999.6 33.6
incinerate Mana 99.0 6534983.1 66000.0 66000.3 7.5
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 109.9 4397.5 40.0 40.0 2880.6
pet - service_imp
firebolt Energy 49.8 1991.4 40.0 40.0 5850.9
pet - doomguard
doom_bolt Energy 11.0 385.0 35.0 35.0 6188.6
Resource Gains Type Count Total Average Overflow
life_tap Mana 10.64 3510476.86 (42.95%) 330000.00 0.00 0.00%
immolate Soul Shard 65.09 64.90 (46.08%) 1.00 0.19 0.29%
conflagrate Soul Shard 49.01 49.01 (34.80%) 1.00 0.00 0.00%
mp5_regen Mana 543.91 4663569.81 (57.05%) 8574.16 17956.43 0.38%
soulsnatcher Soul Shard 10.28 10.28 (7.30%) 1.00 0.00 0.00%
feretory_of_souls Soul Shard 16.66 16.65 (11.82%) 1.00 0.01 0.05%
pet - imp
energy_regen Energy 1872.55 4231.43 (100.00%) 2.26 22.80 0.54%
pet - service_imp
energy_regen Energy 436.73 1376.68 (100.00%) 3.15 64.89 4.50%
pet - doomguard
energy_regen Energy 11.00 349.94 (100.00%) 31.81 45.55 11.52%
Resource RPS-Gain RPS-Loss
Health 0.00 11298.11
Mana 27145.98 30010.30
Soul Shard 0.47 0.47
Combat End Resource Mean Min Max
Mana 234671.21 2884.36 499483.34
Soul Shard 1.43 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.2%

Statistics & Data Analysis

Fight Length
Sample Data Feretory_BD Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Feretory_BD Damage Per Second
Count 9999
Mean 949839.07
Minimum 854995.47
Maximum 1092553.02
Spread ( max - min ) 237557.55
Range [ ( max - min ) / 2 * 100% ] 12.51%
Standard Deviation 31709.0565
5th Percentile 900450.26
95th Percentile 1004695.72
( 95th Percentile - 5th Percentile ) 104245.47
Mean Distribution
Standard Deviation 317.1064
95.00% Confidence Intervall ( 949217.55 - 950460.58 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4282
0.1 Scale Factor Error with Delta=300 8583222
0.05 Scale Factor Error with Delta=300 34332885
0.01 Scale Factor Error with Delta=300 858322125
Priority Target DPS
Sample Data Feretory_BD Priority Target Damage Per Second
Count 9999
Mean 556235.70
Minimum 501187.24
Maximum 639041.61
Spread ( max - min ) 137854.37
Range [ ( max - min ) / 2 * 100% ] 12.39%
Standard Deviation 18974.2291
5th Percentile 526345.79
95th Percentile 588543.35
( 95th Percentile - 5th Percentile ) 62197.56
Mean Distribution
Standard Deviation 189.7518
95.00% Confidence Intervall ( 555863.79 - 556607.60 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4470
0.1 Scale Factor Error with Delta=300 3073350
0.05 Scale Factor Error with Delta=300 12293398
0.01 Scale Factor Error with Delta=300 307334948
DPS(e)
Sample Data Feretory_BD Damage Per Second (Effective)
Count 9999
Mean 949839.07
Minimum 854995.47
Maximum 1092553.02
Spread ( max - min ) 237557.55
Range [ ( max - min ) / 2 * 100% ] 12.51%
Damage
Sample Data Feretory_BD Damage
Count 9999
Mean 232997713.70
Minimum 166205070.49
Maximum 312167975.04
Spread ( max - min ) 145962904.55
Range [ ( max - min ) / 2 * 100% ] 31.32%
DTPS
Sample Data Feretory_BD Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Feretory_BD Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Feretory_BD Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Feretory_BD Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Feretory_BD Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Feretory_BD Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Feretory_BDTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Feretory_BD Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.91 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 4.40 immolate,if=remains<=tick_time
F 0.82 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
G 2.07 berserking
0.00 blood_fury
0.00 arcane_torrent
H 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
I 25.03 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
J 1.44 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
K 3.73 service_pet
L 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
M 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
N 2.94 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
O 13.12 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
P 67.61 chaos_bolt
0.00 shadowburn
Q 22.55 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
R 12.87 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 99.37 incinerate
T 10.64 life_tap

Sample Sequence

0126ABCDEGIKLNOOSSPPQPSISOSJPRPICPSQPPIPSSSSIPSSPRPISSPSICPSPOIPSPRSIPSSSQCPSSSPQPRSTQPSSSOSSPCQPPPSIPEOSIKSTSSSSIPCPSSTIPESOISSPSQPCSRNHSQSTPSPPQOPPSIPCRSSISSOPQSSPSPTRQSSOCSSTQPSSSQPSRPIOGPCKSPQSSSSIPSPRTIPSSCOPQPSSIRSSSTQPSPCIOPSPSIPRMSSQSSSTSCINOPRSIPSSSSTSISSSSPSCIOEOPKIPPSQPSTSRCQFPSSIPPSPSO

Sample Sequence Table

time name target resources buffs
Pre flask Feretory_BD 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Feretory_BD 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Feretory_BD 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_deadly_grace
0:01.100 dimensional_rift Fluffy_Pillow 1032933.5/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.971 immolate Fluffy_Pillow 1049509.0/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.842 berserking Fluffy_Pillow 1000085.6/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:02.842 conflagrate Fluffy_Pillow 1000085.6/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.597 service_imp Fluffy_Pillow 1016852.2/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, berserking, backdraft(2), conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:04.352 summon_infernal Fluffy_Pillow 1033618.7/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, backdraft(2), conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:05.087 soul_harvest Fluffy_Pillow 1050343.7/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, berserking, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_deadly_grace
0:05.087 dimensional_rift Fluffy_Pillow 1050343.7/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_deadly_grace
0:05.842 dimensional_rift Fluffy_Pillow 1067596.6/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_deadly_grace
0:06.597 incinerate Fluffy_Pillow 1084849.5/1100000: 99% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_deadly_grace
0:07.351 incinerate Fluffy_Pillow 1036079.5/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_deadly_grace
0:08.103 chaos_bolt Fluffy_Pillow 987310.9/1100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5), potion_of_deadly_grace
0:09.533 chaos_bolt Fluffy_Pillow 1020448.9/1100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
0:10.392 conflagrate Fluffy_Pillow 1040354.8/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
0:11.145 chaos_bolt Fluffy_Pillow 1057804.4/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
0:11.900 incinerate Fluffy_Pillow 1075300.3/1100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
0:12.703 conflagrate Fluffy_Pillow 1026776.6/1100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:13.565 incinerate Fluffy_Pillow 1043330.5/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:14.319 dimensional_rift Fluffy_Pillow 991468.4/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:15.202 incinerate Fluffy_Pillow 1008025.1/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:15.958 conflagrate Fluffy_Pillow 956200.5/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
0:16.842 chaos_bolt Fluffy_Pillow 972776.0/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, potion_of_deadly_grace
0:18.078 immolate Fluffy_Pillow 995951.7/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, backdraft, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:18.962 chaos_bolt Fluffy_Pillow 946527.2/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, backdraft, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:19.716 conflagrate Fluffy_Pillow 960665.1/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:20.594 havoc enemy2 977235.0/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:21.452 chaos_bolt Fluffy_Pillow 905803.6/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:22.206 incinerate Fluffy_Pillow 920363.8/1100000: 84% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:22.961 conflagrate Fluffy_Pillow 868943.4/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:23.820 chaos_bolt Fluffy_Pillow 885531.3/1100000: 81% mana | 4.0/5: 80% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:24.575 chaos_bolt Fluffy_Pillow 900121.6/1100000: 82% mana | 2.0/5: 40% soul_shard bloodlust, backdraft, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:25.331 conflagrate Fluffy_Pillow 914932.1/1100000: 83% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:26.178 chaos_bolt Fluffy_Pillow 931525.3/1100000: 85% mana | 2.0/5: 40% soul_shard bloodlust, backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:26.932 incinerate Fluffy_Pillow 946296.7/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:27.686 incinerate Fluffy_Pillow 895068.0/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:28.440 incinerate Fluffy_Pillow 843839.3/1100000: 77% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
0:29.194 incinerate Fluffy_Pillow 792610.6/1100000: 72% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
0:29.949 conflagrate Fluffy_Pillow 741401.6/1100000: 67% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
0:30.702 chaos_bolt Fluffy_Pillow 756153.3/1100000: 69% mana | 3.0/5: 60% soul_shard bloodlust, backdraft(2), lord_of_flames, nefarious_pact, accelerando(3)
0:31.481 incinerate Fluffy_Pillow 771414.4/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
0:32.237 incinerate Fluffy_Pillow 720203.9/1100000: 65% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact
0:32.992 chaos_bolt Fluffy_Pillow 668360.5/1100000: 61% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact
0:33.747 immolate Fluffy_Pillow 682517.2/1100000: 62% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact
0:34.500 chaos_bolt Fluffy_Pillow 630636.4/1100000: 57% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact
0:35.253 conflagrate Fluffy_Pillow 644755.5/1100000: 59% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, nefarious_pact
0:36.009 incinerate Fluffy_Pillow 658930.9/1100000: 60% mana | 1.0/5: 20% soul_shard bloodlust, backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact
0:36.762 incinerate Fluffy_Pillow 607050.1/1100000: 55% mana | 1.0/5: 20% soul_shard bloodlust, backdraft, lord_of_flames, embrace_chaos, nefarious_pact
0:37.515 chaos_bolt Fluffy_Pillow 555169.2/1100000: 50% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due
0:38.762 incinerate Fluffy_Pillow 578551.2/1100000: 53% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due
0:40.010 conflagrate Fluffy_Pillow 536001.4/1100000: 49% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, devils_due, accelerando
0:41.161 havoc enemy2 553245.9/1100000: 50% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, embrace_chaos, devils_due, accelerando
0:42.492 chaos_bolt Fluffy_Pillow 484730.1/1100000: 44% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, embrace_chaos, devils_due, accelerando
0:43.612 incinerate Fluffy_Pillow 501126.7/1100000: 46% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
0:44.715 chaos_bolt Fluffy_Pillow 451511.1/1100000: 41% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
0:46.290 dimensional_rift Fluffy_Pillow 474906.8/1100000: 43% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
0:47.404 conflagrate Fluffy_Pillow 491454.6/1100000: 45% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
0:48.518 chaos_bolt Fluffy_Pillow 508002.4/1100000: 46% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando(2)
0:49.455 incinerate Fluffy_Pillow 521920.9/1100000: 47% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando(2)
0:50.391 chaos_bolt Fluffy_Pillow 469824.6/1100000: 43% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
0:51.727 immolate Fluffy_Pillow 489670.1/1100000: 45% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
0:52.870 incinerate Fluffy_Pillow 440201.9/1100000: 40% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
0:54.247 conflagrate Fluffy_Pillow 394150.2/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
0:55.378 chaos_bolt Fluffy_Pillow 410706.7/1100000: 37% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:56.328 incinerate Fluffy_Pillow 424613.5/1100000: 39% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:57.279 incinerate Fluffy_Pillow 372535.0/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:58.634 incinerate Fluffy_Pillow 326370.6/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:59.991 conflagrate Fluffy_Pillow 280235.5/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:01.246 havoc enemy2 298607.2/1100000: 27% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando
1:02.359 chaos_bolt Fluffy_Pillow 227140.1/1100000: 21% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
1:03.917 incinerate Fluffy_Pillow 250504.2/1100000: 23% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:04.839 incinerate Fluffy_Pillow 198399.1/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:06.137 incinerate Fluffy_Pillow 151985.2/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:07.513 chaos_bolt Fluffy_Pillow 105831.9/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:08.890 conflagrate Fluffy_Pillow 125693.1/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:10.039 chaos_bolt Fluffy_Pillow 142265.7/1100000: 13% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
1:11.003 immolate Fluffy_Pillow 156361.7/1100000: 14% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:12.117 incinerate Fluffy_Pillow 106910.4/1100000: 10% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:12.871 life_tap Fluffy_Pillow 52273.0/1100000: 5% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:13.626 conflagrate Fluffy_Pillow 393650.6/1100000: 36% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:14.369 chaos_bolt Fluffy_Pillow 405007.6/1100000: 37% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
1:15.121 incinerate Fluffy_Pillow 416535.9/1100000: 38% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
1:15.874 incinerate Fluffy_Pillow 362207.9/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
1:16.719 incinerate Fluffy_Pillow 309305.9/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
1:17.564 dimensional_rift Fluffy_Pillow 256403.9/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
1:18.315 incinerate Fluffy_Pillow 268044.9/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
1:19.158 incinerate Fluffy_Pillow 215111.9/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(5)
1:20.001 chaos_bolt Fluffy_Pillow 162178.9/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(5)
1:21.404 havoc enemy2 183926.3/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
1:22.161 conflagrate Fluffy_Pillow 107611.8/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:22.917 chaos_bolt Fluffy_Pillow 118515.9/1100000: 11% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact
1:23.670 chaos_bolt Fluffy_Pillow 129376.8/1100000: 12% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, embrace_chaos, nefarious_pact
1:24.425 chaos_bolt Fluffy_Pillow 140266.6/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due
1:26.045 incinerate Fluffy_Pillow 163632.6/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due
1:27.667 conflagrate Fluffy_Pillow 121027.5/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due
1:29.018 chaos_bolt Fluffy_Pillow 140513.7/1100000: 13% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, embrace_chaos, devils_due
1:30.154 immolate Fluffy_Pillow 156899.8/1100000: 14% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, embrace_chaos, devils_due, accelerando
1:31.485 dimensional_rift Fluffy_Pillow 110384.1/1100000: 10% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, embrace_chaos, devils_due, accelerando
1:32.818 incinerate Fluffy_Pillow 129897.6/1100000: 12% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando
1:33.769 conflagrate Fluffy_Pillow 77820.2/1100000: 7% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:34.524 service_imp Fluffy_Pillow 89035.2/1100000: 8% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, nefarious_pact, accelerando(2)
1:35.278 incinerate Fluffy_Pillow 100235.5/1100000: 9% mana | 0.0/5: 0% soul_shard backdraft(2), lord_of_flames, nefarious_pact, accelerando(2)
1:36.032 life_tap Fluffy_Pillow 45435.7/1100000: 4% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, nefarious_pact, accelerando(2)
1:36.785 incinerate Fluffy_Pillow 386621.0/1100000: 35% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, nefarious_pact, accelerando(2)
1:37.539 incinerate Fluffy_Pillow 331821.3/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact, accelerando(2)
1:38.418 incinerate Fluffy_Pillow 278878.3/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact, accelerando(2)
1:39.301 incinerate Fluffy_Pillow 225994.7/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact, accelerando(2)
1:40.181 conflagrate Fluffy_Pillow 173066.6/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando(2)
1:40.937 chaos_bolt Fluffy_Pillow 184296.5/1100000: 17% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, nefarious_pact, accelerando(2)
1:41.962 havoc enemy2 199522.3/1100000: 18% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:42.734 chaos_bolt Fluffy_Pillow 122737.8/1100000: 11% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, embrace_chaos, nefarious_pact
1:43.483 incinerate Fluffy_Pillow 133627.8/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:44.375 incinerate Fluffy_Pillow 80685.6/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:45.267 life_tap Fluffy_Pillow 27743.4/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
1:46.600 conflagrate Fluffy_Pillow 377256.9/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando
1:47.964 chaos_bolt Fluffy_Pillow 397224.2/1100000: 36% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, devils_due, accelerando
1:49.827 immolate Fluffy_Pillow 424496.3/1100000: 39% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, embrace_chaos, devils_due, accelerando
1:51.159 incinerate Fluffy_Pillow 377996.0/1100000: 34% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:52.262 dimensional_rift Fluffy_Pillow 328380.4/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:53.573 conflagrate Fluffy_Pillow 347854.6/1100000: 32% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:54.687 incinerate Fluffy_Pillow 364402.4/1100000: 33% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2)
1:55.624 incinerate Fluffy_Pillow 312086.5/1100000: 28% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
1:56.588 chaos_bolt Fluffy_Pillow 259990.8/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
1:58.881 incinerate Fluffy_Pillow 293063.8/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:00.259 conflagrate Fluffy_Pillow 246939.4/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:01.405 chaos_bolt Fluffy_Pillow 263468.7/1100000: 24% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
2:02.371 havoc enemy2 277403.1/1100000: 25% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:03.502 incinerate Fluffy_Pillow 205959.6/1100000: 19% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:04.452 immolate Fluffy_Pillow 153867.3/1100000: 14% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:05.566 soul_harvest Fluffy_Pillow 104415.1/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:05.566 potion Fluffy_Pillow 104415.1/1100000: 9% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:05.566 incinerate Fluffy_Pillow 104415.1/1100000: 9% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:06.902 conflagrate Fluffy_Pillow 58260.6/1100000: 5% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:08.042 incinerate Fluffy_Pillow 75194.6/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:08.979 life_tap Fluffy_Pillow 23113.2/1100000: 2% mana | 1.0/5: 20% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:10.092 chaos_bolt Fluffy_Pillow 369646.1/1100000: 34% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:11.651 incinerate Fluffy_Pillow 392804.2/1100000: 36% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:12.987 chaos_bolt Fluffy_Pillow 346650.5/1100000: 32% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:14.306 chaos_bolt Fluffy_Pillow 366586.7/1100000: 33% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:15.604 conflagrate Fluffy_Pillow 385360.1/1100000: 35% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:16.735 dimensional_rift Fluffy_Pillow 401916.6/1100000: 37% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:17.866 chaos_bolt Fluffy_Pillow 418473.1/1100000: 38% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:18.815 chaos_bolt Fluffy_Pillow 432365.3/1100000: 39% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:19.766 incinerate Fluffy_Pillow 446286.8/1100000: 41% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:21.124 conflagrate Fluffy_Pillow 400166.3/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:22.255 chaos_bolt Fluffy_Pillow 416722.8/1100000: 38% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:23.206 havoc enemy2 430700.3/1100000: 39% mana | 0.0/5: 0% soul_shard soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:24.305 immolate Fluffy_Pillow 359262.0/1100000: 33% mana | 0.0/5: 0% soul_shard soul_harvest, backdraft, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:25.404 incinerate Fluffy_Pillow 309866.9/1100000: 28% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:26.314 incinerate Fluffy_Pillow 257777.4/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:27.597 conflagrate Fluffy_Pillow 211664.7/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando(5), potion_of_deadly_grace
2:28.745 incinerate Fluffy_Pillow 228226.1/1100000: 21% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:29.708 incinerate Fluffy_Pillow 176115.9/1100000: 16% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:30.671 dimensional_rift Fluffy_Pillow 124005.7/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:31.817 chaos_bolt Fluffy_Pillow 140535.0/1100000: 13% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:34.110 conflagrate Fluffy_Pillow 173608.1/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:34.865 incinerate Fluffy_Pillow 184497.9/1100000: 17% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:35.619 incinerate Fluffy_Pillow 129373.2/1100000: 12% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:36.372 chaos_bolt Fluffy_Pillow 74234.1/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:37.276 incinerate Fluffy_Pillow 87361.8/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:38.168 chaos_bolt Fluffy_Pillow 34419.6/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:39.059 life_tap Fluffy_Pillow 47462.8/1100000: 4% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:39.814 immolate Fluffy_Pillow 388515.1/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:40.568 conflagrate Fluffy_Pillow 333552.7/1100000: 30% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:41.321 incinerate Fluffy_Pillow 344575.8/1100000: 31% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:42.066 incinerate Fluffy_Pillow 289640.8/1100000: 26% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
2:42.821 dimensional_rift Fluffy_Pillow 234855.9/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
2:43.575 havoc enemy2 246056.1/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
2:44.329 incinerate Fluffy_Pillow 169256.3/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
2:45.209 incinerate Fluffy_Pillow 116328.2/1100000: 11% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
2:46.091 life_tap Fluffy_Pillow 63429.7/1100000: 6% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
2:47.403 conflagrate Fluffy_Pillow 412918.7/1100000: 38% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
2:48.713 chaos_bolt Fluffy_Pillow 432378.0/1100000: 39% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
2:50.550 incinerate Fluffy_Pillow 459253.6/1100000: 42% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:51.670 incinerate Fluffy_Pillow 409650.1/1100000: 37% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
2:53.246 incinerate Fluffy_Pillow 367060.6/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
2:54.819 conflagrate Fluffy_Pillow 324426.6/1100000: 29% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
2:55.933 chaos_bolt Fluffy_Pillow 340974.4/1100000: 31% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, accelerando(2)
2:57.492 incinerate Fluffy_Pillow 364320.2/1100000: 33% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando(3)
2:58.417 immolate Fluffy_Pillow 312259.6/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:59.516 chaos_bolt Fluffy_Pillow 262821.3/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:00.833 conflagrate Fluffy_Pillow 282668.1/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:01.968 dimensional_rift Fluffy_Pillow 299202.9/1100000: 27% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
3:03.114 berserking Fluffy_Pillow 315732.2/1100000: 29% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
3:03.114 chaos_bolt Fluffy_Pillow 315732.2/1100000: 29% mana | 3.0/5: 60% soul_shard berserking, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
3:03.953 havoc enemy2 329831.4/1100000: 30% mana | 2.0/5: 40% soul_shard berserking, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:04.920 service_imp Fluffy_Pillow 258350.3/1100000: 23% mana | 2.0/5: 40% soul_shard berserking, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:05.889 incinerate Fluffy_Pillow 274903.3/1100000: 25% mana | 1.0/5: 20% soul_shard berserking, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:06.705 chaos_bolt Fluffy_Pillow 223044.2/1100000: 20% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:07.835 conflagrate Fluffy_Pillow 242907.4/1100000: 22% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:08.776 incinerate Fluffy_Pillow 259448.4/1100000: 24% mana | 1.0/5: 20% soul_shard berserking, backdraft(2), lord_of_flames, embrace_chaos, accelerando(4)
3:09.566 incinerate Fluffy_Pillow 207335.1/1100000: 19% mana | 1.0/5: 20% soul_shard berserking, backdraft, lord_of_flames, embrace_chaos, accelerando(4)
3:10.358 incinerate Fluffy_Pillow 155257.0/1100000: 14% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(4)
3:11.488 incinerate Fluffy_Pillow 109120.2/1100000: 10% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(4)
3:12.618 conflagrate Fluffy_Pillow 62984.5/1100000: 6% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, accelerando(5)
3:13.611 chaos_bolt Fluffy_Pillow 79529.8/1100000: 7% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, accelerando(5)
3:15.106 incinerate Fluffy_Pillow 102703.3/1100000: 9% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando(5)
3:16.003 chaos_bolt Fluffy_Pillow 49762.8/1100000: 5% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:17.381 immolate Fluffy_Pillow 69638.4/1100000: 6% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
3:18.530 life_tap Fluffy_Pillow 20212.3/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:19.663 conflagrate Fluffy_Pillow 366798.1/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:20.794 chaos_bolt Fluffy_Pillow 383354.6/1100000: 35% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:21.745 incinerate Fluffy_Pillow 397276.1/1100000: 36% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:22.696 incinerate Fluffy_Pillow 345197.5/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:24.052 havoc enemy2 299047.8/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:25.184 dimensional_rift Fluffy_Pillow 227618.9/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:26.298 chaos_bolt Fluffy_Pillow 244166.7/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
3:28.521 conflagrate Fluffy_Pillow 277188.0/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:29.634 chaos_bolt Fluffy_Pillow 293721.0/1100000: 27% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando(2)
3:30.571 incinerate Fluffy_Pillow 307680.4/1100000: 28% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, embrace_chaos
3:31.536 incinerate Fluffy_Pillow 255599.1/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
3:32.913 conflagrate Fluffy_Pillow 209460.3/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos
3:34.059 immolate Fluffy_Pillow 225989.6/1100000: 21% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
3:35.207 incinerate Fluffy_Pillow 176547.7/1100000: 16% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:36.172 incinerate Fluffy_Pillow 124466.4/1100000: 11% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:37.137 incinerate Fluffy_Pillow 72385.1/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:38.513 life_tap Fluffy_Pillow 26231.8/1100000: 2% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:39.660 conflagrate Fluffy_Pillow 372775.6/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
3:40.809 chaos_bolt Fluffy_Pillow 389348.2/1100000: 35% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames
3:42.415 incinerate Fluffy_Pillow 412685.8/1100000: 38% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando
3:43.364 chaos_bolt Fluffy_Pillow 360699.9/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:44.701 havoc enemy2 380560.2/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:45.816 conflagrate Fluffy_Pillow 309122.8/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:47.082 dimensional_rift Fluffy_Pillow 327928.5/1100000: 30% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando(2)
3:48.196 chaos_bolt Fluffy_Pillow 344476.3/1100000: 31% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, embrace_chaos, accelerando(2)
3:49.131 incinerate Fluffy_Pillow 358365.8/1100000: 33% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, accelerando(3)
3:50.053 chaos_bolt Fluffy_Pillow 306260.1/1100000: 28% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:51.371 incinerate Fluffy_Pillow 326122.0/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:52.689 conflagrate Fluffy_Pillow 279983.8/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:53.797 chaos_bolt Fluffy_Pillow 296559.6/1100000: 27% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
3:54.761 immolate Fluffy_Pillow 310463.8/1100000: 28% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:55.908 summon_doomguard Fluffy_Pillow 261008.4/1100000: 24% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:57.040 incinerate Fluffy_Pillow 277579.6/1100000: 25% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:57.990 incinerate Fluffy_Pillow 225487.3/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:59.327 conflagrate Fluffy_Pillow 179348.7/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
4:00.425 incinerate Fluffy_Pillow 195895.2/1100000: 18% mana | 1.0/5: 20% soul_shard backdraft(2), lord_of_flames, accelerando(3)
4:01.349 incinerate Fluffy_Pillow 143820.7/1100000: 13% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, accelerando(4)
4:02.260 incinerate Fluffy_Pillow 91745.6/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
4:03.560 life_tap Fluffy_Pillow 45616.5/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
4:04.644 incinerate Fluffy_Pillow 392185.8/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
4:05.943 havoc enemy2 346041.4/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
4:07.027 conflagrate Fluffy_Pillow 274610.7/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
4:08.110 soul_harvest Fluffy_Pillow 291176.0/1100000: 26% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames
4:08.110 dimensional_rift Fluffy_Pillow 291176.0/1100000: 26% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft(2), lord_of_flames
4:09.257 chaos_bolt Fluffy_Pillow 307719.7/1100000: 28% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft(2), lord_of_flames
4:10.861 immolate Fluffy_Pillow 330855.0/1100000: 30% mana | 0.0/5: 0% soul_shard soul_harvest, backdraft, lord_of_flames, embrace_chaos
4:12.010 incinerate Fluffy_Pillow 281427.6/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, backdraft, lord_of_flames, embrace_chaos
4:12.973 conflagrate Fluffy_Pillow 229317.4/1100000: 21% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact
4:13.730 chaos_bolt Fluffy_Pillow 240236.0/1100000: 22% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, nefarious_pact
4:14.484 incinerate Fluffy_Pillow 251111.3/1100000: 23% mana | 0.0/5: 0% soul_shard soul_harvest, backdraft, lord_of_flames, embrace_chaos, nefarious_pact
4:15.238 incinerate Fluffy_Pillow 195986.6/1100000: 18% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact
4:16.144 incinerate Fluffy_Pillow 143055.2/1100000: 13% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:17.038 incinerate Fluffy_Pillow 90183.2/1100000: 8% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:17.918 life_tap Fluffy_Pillow 37255.1/1100000: 3% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:18.672 incinerate Fluffy_Pillow 378455.3/1100000: 34% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando(2)
4:19.554 conflagrate Fluffy_Pillow 325556.9/1100000: 30% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando(2)
4:20.310 incinerate Fluffy_Pillow 336786.8/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, backdraft(2), lord_of_flames, nefarious_pact, accelerando(2)
4:21.065 incinerate Fluffy_Pillow 282001.9/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, backdraft, lord_of_flames, nefarious_pact, accelerando(2)
4:21.820 incinerate Fluffy_Pillow 227217.0/1100000: 21% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando(2)
4:22.699 incinerate Fluffy_Pillow 174274.0/1100000: 16% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando(2)
4:23.580 chaos_bolt Fluffy_Pillow 121360.7/1100000: 11% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, nefarious_pact, accelerando(2)
4:25.045 incinerate Fluffy_Pillow 143122.4/1100000: 13% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:26.620 havoc enemy2 100519.2/1100000: 9% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(3)
4:27.912 conflagrate Fluffy_Pillow 32006.0/1100000: 3% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(4)
4:29.250 dimensional_rift Fluffy_Pillow 51501.2/1100000: 5% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, devils_due
4:30.603 immolate Fluffy_Pillow 71016.2/1100000: 6% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, devils_due
4:31.954 dimensional_rift Fluffy_Pillow 24502.3/1100000: 2% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, devils_due
4:33.306 chaos_bolt Fluffy_Pillow 44002.9/1100000: 4% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames
4:34.912 service_imp Fluffy_Pillow 67167.0/1100000: 6% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, embrace_chaos
4:36.067 conflagrate Fluffy_Pillow 83826.1/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:37.214 chaos_bolt Fluffy_Pillow 100369.9/1100000: 9% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
4:38.178 chaos_bolt Fluffy_Pillow 114274.1/1100000: 10% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:39.142 incinerate Fluffy_Pillow 128179.2/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:40.497 conflagrate Fluffy_Pillow 82014.8/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:41.627 chaos_bolt Fluffy_Pillow 98556.7/1100000: 9% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:42.578 incinerate Fluffy_Pillow 112478.1/1100000: 10% mana | 0.0/5: 0% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:43.528 life_tap Fluffy_Pillow 60385.0/1100000: 5% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:44.658 incinerate Fluffy_Pillow 406965.7/1100000: 37% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:45.997 immolate Fluffy_Pillow 360857.2/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:47.094 havoc enemy2 311388.7/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
4:48.194 conflagrate Fluffy_Pillow 239965.4/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
4:49.275 immolate enemy2 256488.8/1100000: 23% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, accelerando(4)
4:50.358 chaos_bolt Fluffy_Pillow 207042.8/1100000: 19% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, accelerando(4)
4:51.873 incinerate Fluffy_Pillow 229566.6/1100000: 21% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos
4:52.837 incinerate Fluffy_Pillow 177470.8/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
4:54.214 conflagrate Fluffy_Pillow 131332.0/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
4:54.971 chaos_bolt Fluffy_Pillow 142250.5/1100000: 13% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:55.721 chaos_bolt Fluffy_Pillow 153093.8/1100000: 14% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:56.472 incinerate Fluffy_Pillow 164134.1/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:57.353 chaos_bolt Fluffy_Pillow 111220.8/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:58.234 incinerate Fluffy_Pillow 124307.6/1100000: 11% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:59.115 dimensional_rift Fluffy_Pillow 71529.5/1100000: 7% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 53301 53301 34742
Intellect 50545 48839 39190 (1278)
Spirit 1 1 0
Health 3198060 3198060 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50545 48839 0
Crit 13.94% 13.94% 3577
Haste 31.12% 30.12% 11296
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14423 14313 0
Mastery 68.22% 68.22% 5896
Armor 1981 1981 1981
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Feretory of Souls
ilevel: 940, stats: { 202 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Feretory_BD"
level=110
race=troll
role=spell
position=back
talents=1203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=feretory_of_souls,id=132456,ilevel=940
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=907.27
# gear_stamina=34742
# gear_intellect=39190
# gear_crit_rating=3577
# gear_haste_rating=11296
# gear_mastery_rating=5896
# gear_versatility_rating=2829
# gear_armor=1981
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Feretory_RB : 1007396 dps, 584647 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1007396.3 1007396.3 681.8 / 0.068% 136555.4 / 13.6% 32.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
25671.9 25671.9 Mana 0.00% 51.6 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Feretory_RB 1007396
Chaos Bolt 333164 33.1% 65.8 4.44sec 1523649 1054899 Direct 126.2 0 794063 794063 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.78 126.22 0.00 0.00 1.4444 0.0000 100229080.08 100229080.08 0.00 1054898.59 1054898.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 126.22 100.00% 794063.18 519797 1175190 794122.88 744546 840726 100229080 100229080 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 108100 10.7% 48.9 6.15sec 664843 648938 Direct 97.1 198554 446495 334470 54.8%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.86 97.11 0.00 0.00 1.0245 0.0000 32481277.55 32481277.55 0.00 648937.68 648937.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.88 45.18% 198554.23 131238 296698 198600.56 176549 220456 8711742 8711742 0.00
crit 53.24 54.82% 446495.38 262466 676128 446562.78 399657 492289 23769536 23769536 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 12599 1.2% 33.1 4.96sec 112445 0 Direct 33.1 98672 197278 112445 14.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.10 33.10 0.00 0.00 0.0000 0.0000 3722468.00 3722468.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.48 86.03% 98671.54 87244 104693 98670.95 93787 102599 2810210 2810210 0.00
crit 4.62 13.97% 197278.30 174488 209385 195774.48 0 209385 912258 912258 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 248378 24.7% 20.2 15.06sec 3698442 3553258 Direct 38.9 136718 273380 199464 45.9%  
Periodic 300.0 152711 305555 222938 45.9% 195.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.18 38.88 300.04 300.04 1.0409 1.9657 74646835.03 74646835.03 0.00 122210.58 3553257.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.03 54.09% 136718.37 91048 205843 136652.62 108222 158403 2875496 2875496 0.00
crit 17.85 45.91% 273380.38 182095 411680 273340.77 232691 318918 4880339 4880339 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 162.2 54.05% 152711.01 28 519431 152878.56 130323 180371 24766865 24766865 0.00
crit 137.9 45.95% 305555.23 50 1052758 305925.73 250195 363785 42124135 42124135 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 126103 12.5% 77.1 3.72sec 492759 409108 Direct 147.0 226772 453493 258354 13.9%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.06 146.97 0.00 0.00 1.2045 0.0000 37969746.35 37969746.35 0.00 409108.26 409108.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 126.50 86.07% 226771.51 147178 332746 226779.18 210823 241367 28686388 28686388 0.00
crit 20.47 13.93% 453492.68 294377 665488 453383.26 386505 540689 9283358 9283358 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 8846 0.9% 20.2 14.84sec 131524 0 Direct 20.2 115404 230880 131522 14.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.22 20.22 0.00 0.00 0.0000 0.0000 2659764.69 2659764.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.40 86.04% 115403.65 111395 133674 115409.97 111395 124126 2007967 2007967 0.00
crit 2.82 13.96% 230880.26 222790 267348 218139.91 0 267348 651798 651798 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 42003 / 42003
Firebolt 42003 4.2% 109.9 2.74sec 114899 93152 Direct 109.1 101593 203235 115784 14.0%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.91 109.07 0.00 0.00 1.2335 0.0000 12628688.69 12628688.69 0.00 93151.84 93151.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.84 86.04% 101593.04 65724 118304 101600.09 99150 103762 9533932 9533932 0.00
crit 15.23 13.96% 203234.83 131449 236608 203239.53 153357 225341 3094756 3094756 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 120578 / 38488
Firebolt 120578 3.8% 49.4 5.50sec 233750 201094 Direct 49.1 206169 412486 235058 14.0%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.37 49.10 0.00 0.00 1.1624 0.0000 11540987.82 11540987.82 0.00 201094.04 201094.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.22 86.00% 206168.56 131449 236608 206319.59 198816 212708 8705153 8705153 0.00
crit 6.87 14.00% 412486.00 262898 473216 412455.49 0 473216 2835835 2835835 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 106843 / 9042
Immolation 82244 0.7% 1.0 0.00sec 2056173 0 Periodic 44.7 40364 80747 45993 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.35 44.71 0.0000 1.0879 2056172.73 2056172.73 0.00 84557.01 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.5 86.06% 40364.31 34811 41773 40365.93 39452 41193 1553017 1553017 0.00
crit 6.2 13.94% 80747.35 69622 83546 80648.28 0 83546 503155 503155 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24599 0.2% 22.4 1.09sec 27513 25291 Direct 22.4 24137 48302 27513 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.35 22.35 0.00 0.00 1.0879 0.0000 615006.80 904118.25 31.98 25291.23 25291.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.23 86.03% 24136.79 20817 24980 24137.68 23593 24980 464146 682339 31.98
crit 3.12 13.97% 48301.72 41634 49961 46471.02 0 49961 150861 221779 30.77
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 95359 / 8057
Doom Bolt 95359 0.8% 11.0 2.23sec 216716 97380 Direct 11.0 190042 379979 216730 14.0%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.00 11.00 0.00 0.00 2.2255 0.0000 2384067.91 2384067.91 0.00 97380.44 97380.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.46 85.95% 190042.27 183803 220564 190038.02 183803 220564 1796831 1796831 0.00
crit 1.55 14.05% 379979.02 367607 441128 307638.66 0 441128 587237 587237 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 106781 / 9036
Immolation 82205 0.7% 1.0 0.00sec 2055210 0 Periodic 44.7 40367 80717 45971 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.35 44.71 0.0000 1.0879 2055209.76 2055209.76 0.00 84517.41 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.5 86.11% 40366.74 34811 41773 40368.45 39646 41375 1553980 1553980 0.00
crit 6.2 13.89% 80717.31 69622 83546 80597.08 0 83546 501229 501229 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24576 0.2% 22.4 1.09sec 27487 25267 Direct 22.4 24138 48291 27487 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.35 22.35 0.00 0.00 1.0879 0.0000 614428.44 903268.01 31.98 25267.44 25267.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.25 86.13% 24137.64 20817 24980 24138.67 23315 24980 464725 683189 31.98
crit 3.10 13.87% 48291.40 41634 49961 46592.31 0 49961 149704 220079 30.85
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 106835 / 9039
Immolation 82217 0.7% 1.0 0.00sec 2055499 0 Periodic 44.7 40365 80734 45977 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.35 44.71 0.0000 1.0879 2055499.42 2055499.42 0.00 84529.32 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.5 86.10% 40365.37 34811 41773 40367.07 39521 41351 1553691 1553691 0.00
crit 6.2 13.90% 80734.24 69622 83546 80626.36 0 83546 501809 501809 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24618 0.2% 22.4 1.09sec 27534 25310 Direct 22.4 24137 48297 27535 14.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.35 22.35 0.00 0.00 1.0879 0.0000 615475.23 904806.89 31.98 25310.49 25310.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.21 85.94% 24137.17 20817 24980 24138.15 23494 24980 463678 681650 31.98
crit 3.14 14.06% 48296.86 41634 49961 46684.57 0 49961 151797 223157 30.92
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 106831 / 9041
Immolation 82233 0.7% 1.0 0.00sec 2055907 0 Periodic 44.7 40364 80752 45987 13.9% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.35 44.71 0.0000 1.0879 2055907.44 2055907.44 0.00 84546.10 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.5 86.08% 40363.97 34811 41773 40365.74 39515 41209 1553283 1553283 0.00
crit 6.2 13.92% 80751.63 69622 83546 80663.98 0 83546 502625 502625 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24598 0.2% 22.4 1.09sec 27512 25290 Direct 22.4 24139 48271 27512 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.35 22.35 0.00 0.00 1.0879 0.0000 614984.31 904085.19 31.98 25290.30 25290.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.23 86.02% 24139.26 20817 24980 24140.59 23494 24980 464169 682372 31.98
crit 3.12 13.98% 48271.29 41634 49961 46582.73 0 49961 150816 221713 30.85
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 113221 / 19211
Shadow Bolt 113221 1.9% 4.4 59.63sec 1318547 0 Periodic 46.4 108881 217632 124063 14.0% 19.7%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 0.00 46.63 46.37 0.0000 1.2742 5753283.64 5753283.64 0.00 96830.54 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.9 86.04% 108880.99 111 128534 108758.15 0 128534 4344365 4344365 0.00
crit 6.5 13.96% 217632.26 229 257068 213825.11 0 257068 1408919 1408919 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 135340 / 9331
Chaos Bolt 135340 0.9% 4.4 59.25sec 641112 312323 Direct 4.3 0 645146 645146 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 4.34 0.00 0.00 2.0528 0.0000 2796851.50 2796851.50 0.00 312322.89 312322.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.34 100.00% 645145.84 610226 732271 645264.49 0 732271 2796851 2796851 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 231633 / 17373
Chaos Barrage 231633 1.7% 4.4 59.94sec 1185118 0 Periodic 146.9 31025 62056 35352 13.9% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.38 0.00 147.67 146.95 0.0000 0.1613 5194862.58 5194862.58 0.00 218134.06 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 126.5 86.06% 31024.74 155 35348 30982.35 0 35348 3923266 3923266 0.00
crit 20.5 13.94% 62055.67 310 70696 61963.02 0 70696 1271597 1271597 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Feretory_RB
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Feretory_RB
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.67sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.0 23.56sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.02 0.00 0.00 0.00 0.9949 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Feretory_RB
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Feretory_RB
  • harmful:false
  • if_expr:
 
Havoc 14.9 20.88sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.91 0.00 0.00 0.00 1.0543 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 6.9 32.32sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 0.00 0.00 0.00 1.0218 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.70sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 0.00 0.00 0.00 0.9607 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.82sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.91 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0664 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7536 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.48% 78.48% 1.4(1.4) 19.3

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.72%
  • accelerando_2:24.58%
  • accelerando_3:14.68%
  • accelerando_4:6.56%
  • accelerando_5:2.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.84% 7.39% 0.0(0.0) 2.0

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.62% 0.0(0.0) 1.0

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.4 0.0 12.2sec 12.2sec 49.14% 47.52% 0.0(0.0) 0.7

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.14%

Trigger Attempt Success

  • trigger_pct:50.01%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.5sec 69.5sec 8.72% 8.72% 0.0(0.0) 3.2

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.4 40.4 11.6sec 4.4sec 65.13% 72.38% 40.4(40.4) 25.7

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:65.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.99% 97.99% 0.0(0.0) 0.0

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.8sec 69.2sec 13.56% 13.56% 0.0(0.0) 3.3

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.56%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 127.7sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 120.8sec 120.8sec 17.81% 17.81% 0.0(0.0) 2.7

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.3 59.5sec
chaos_tear 4.3 59.4sec
chaos_portal 4.4 59.7sec
dimension_ripper 3.9 55.2sec

Resources

Resource Usage Type Count Total Average RPE APR
Feretory_RB
chaos_bolt Soul Shard 66.8 133.6 2.0 2.0 750429.2
havoc Mana 14.9 1312407.9 88000.0 87999.6 0.0
immolate Mana 20.2 1332094.2 66000.0 65999.8 56.0
incinerate Mana 77.1 5085655.3 66000.0 66000.0 7.5
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 109.9 4396.4 40.0 40.0 2872.5
pet - service_imp
firebolt Energy 49.4 1975.0 40.0 40.0 5843.6
pet - doomguard
doom_bolt Energy 11.0 385.0 35.0 35.0 6191.9
Resource Gains Type Count Total Average Overflow
life_tap Mana 6.93 2286313.11 (33.30%) 330000.00 0.00 0.00%
immolate Soul Shard 65.69 64.72 (46.91%) 0.99 0.96 1.47%
conflagrate Soul Shard 48.86 48.76 (35.34%) 1.00 0.10 0.19%
mp5_regen Mana 491.55 4578858.34 (66.70%) 9315.11 101966.89 2.18%
soulsnatcher Soul Shard 9.94 9.94 (7.20%) 1.00 0.00 0.00%
feretory_of_souls Soul Shard 14.60 14.56 (10.55%) 1.00 0.04 0.29%
pet - imp
energy_regen Energy 1872.08 4230.55 (100.00%) 2.26 22.81 0.54%
pet - service_imp
energy_regen Energy 431.27 1362.98 (100.00%) 3.16 63.97 4.48%
pet - doomguard
energy_regen Energy 11.00 349.94 (100.00%) 31.81 45.59 11.53%
Resource RPS-Gain RPS-Loss
Health 0.00 7358.37
Mana 22799.36 25671.89
Soul Shard 0.46 0.46
Combat End Resource Mean Min Max
Mana 234747.67 5758.79 500487.41
Soul Shard 1.78 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.6%

Statistics & Data Analysis

Fight Length
Sample Data Feretory_RB Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Feretory_RB Damage Per Second
Count 9999
Mean 1007396.27
Minimum 897143.19
Maximum 1155081.09
Spread ( max - min ) 257937.91
Range [ ( max - min ) / 2 * 100% ] 12.80%
Standard Deviation 34783.8802
5th Percentile 952618.35
95th Percentile 1067124.92
( 95th Percentile - 5th Percentile ) 114506.57
Mean Distribution
Standard Deviation 347.8562
95.00% Confidence Intervall ( 1006714.49 - 1008078.06 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4580
0.1 Scale Factor Error with Delta=300 10328559
0.05 Scale Factor Error with Delta=300 41314235
0.01 Scale Factor Error with Delta=300 1032855870
Priority Target DPS
Sample Data Feretory_RB Priority Target Damage Per Second
Count 9999
Mean 584647.30
Minimum 521901.07
Maximum 673042.05
Spread ( max - min ) 151140.98
Range [ ( max - min ) / 2 * 100% ] 12.93%
Standard Deviation 20378.8668
5th Percentile 552833.35
95th Percentile 619659.44
( 95th Percentile - 5th Percentile ) 66826.09
Mean Distribution
Standard Deviation 203.7989
95.00% Confidence Intervall ( 584247.86 - 585046.74 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4668
0.1 Scale Factor Error with Delta=300 3545225
0.05 Scale Factor Error with Delta=300 14180898
0.01 Scale Factor Error with Delta=300 354522441
DPS(e)
Sample Data Feretory_RB Damage Per Second (Effective)
Count 9999
Mean 1007396.27
Minimum 897143.19
Maximum 1155081.09
Spread ( max - min ) 257937.91
Range [ ( max - min ) / 2 * 100% ] 12.80%
Damage
Sample Data Feretory_RB Damage
Count 9999
Mean 251709171.70
Minimum 176811459.71
Maximum 331787943.08
Spread ( max - min ) 154976483.37
Range [ ( max - min ) / 2 * 100% ] 30.78%
DTPS
Sample Data Feretory_RB Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Feretory_RB Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Feretory_RB Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Feretory_RB Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Feretory_RB Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Feretory_RB Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Feretory_RBTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Feretory_RB Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 14.91 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.35 immolate,if=remains<=tick_time
F 0.73 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.15 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 14.06 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.80 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
L 3.68 service_pet
M 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
N 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
O 2.91 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
P 12.02 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
Q 66.12 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
R 77.38 incinerate
S 6.93 life_tap

Sample Sequence

0126ABCDEGHJKLKMOPPQKQRKRRQRKQCRPQRREQRPQRRGJQKQKQKCQRRRKRPQRPRQRRERPRCQGJQKQKQKQRQRKQCRRPQEQRPQRSGJKKCLQKQRQRKQQRRRRRRQEQSCRROIRGJKQKPQKQRRCKQRFQESRRRQQRGCJKQKQKQRRFRKPQCEHQQRQSRLRRGJQKQQCKKQQRKRQRQREQRRRPSCGJQKNKQKQQRRKRORCRPERRSRRRRGJKQKCPQQJQRJQRRLREJRSCJQRRR

Sample Sequence Table

time name target resources buffs
Pre flask Feretory_RB 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Feretory_RB 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Feretory_RB 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, accelerando, potion_of_deadly_grace
0:01.101 dimensional_rift Fluffy_Pillow 1032952.5/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.975 immolate Fluffy_Pillow 1049585.1/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.845 immolate Fluffy_Pillow 1000142.4/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.703 berserking Fluffy_Pillow 950711.0/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.703 conflagrate Fluffy_Pillow 950711.0/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:04.459 conflagrate Fluffy_Pillow 967499.8/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:05.213 service_imp Fluffy_Pillow 984244.1/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, accelerando(2), potion_of_deadly_grace
0:05.968 conflagrate Fluffy_Pillow 1001010.6/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, accelerando(2), potion_of_deadly_grace
0:06.725 summon_infernal Fluffy_Pillow 1017821.6/1100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, berserking, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:07.479 soul_harvest Fluffy_Pillow 1034565.9/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:07.479 dimensional_rift Fluffy_Pillow 1034565.9/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:08.234 dimensional_rift Fluffy_Pillow 1051332.4/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:08.989 chaos_bolt Fluffy_Pillow 1068099.0/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:10.478 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:11.232 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:12.114 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:13.037 conflagrate Fluffy_Pillow 1034107.8/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, berserking, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:13.821 incinerate Fluffy_Pillow 1050681.4/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:14.880 incinerate Fluffy_Pillow 1004538.2/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:15.941 chaos_bolt Fluffy_Pillow 958432.6/1100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:17.000 incinerate Fluffy_Pillow 978289.4/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:18.059 conflagrate Fluffy_Pillow 932146.2/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:18.943 chaos_bolt Fluffy_Pillow 948721.7/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:20.000 havoc enemy2 968541.6/1100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:20.872 incinerate Fluffy_Pillow 897136.1/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:21.915 dimensional_rift Fluffy_Pillow 850984.9/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:22.786 chaos_bolt Fluffy_Pillow 867560.4/1100000: 79% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:23.830 incinerate Fluffy_Pillow 887459.3/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:24.860 incinerate Fluffy_Pillow 841350.7/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:25.875 immolate Fluffy_Pillow 795235.2/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:26.724 chaos_bolt Fluffy_Pillow 745867.6/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:27.739 incinerate Fluffy_Pillow 765752.1/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:28.752 dimensional_rift Fluffy_Pillow 719597.4/1100000: 65% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3)
0:29.599 chaos_bolt Fluffy_Pillow 736190.7/1100000: 67% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3)
0:30.613 incinerate Fluffy_Pillow 756055.5/1100000: 69% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(3)
0:31.627 incinerate Fluffy_Pillow 709921.5/1100000: 65% mana | 0.0/5: 0% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando(4)
0:32.627 immolate Fluffy_Pillow 663087.7/1100000: 60% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos
0:33.510 conflagrate Fluffy_Pillow 613644.5/1100000: 56% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos
0:34.393 chaos_bolt Fluffy_Pillow 630201.2/1100000: 57% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, embrace_chaos
0:35.451 conflagrate Fluffy_Pillow 650040.1/1100000: 59% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, embrace_chaos, accelerando
0:36.321 chaos_bolt Fluffy_Pillow 666596.6/1100000: 61% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:37.366 conflagrate Fluffy_Pillow 686484.8/1100000: 62% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:38.225 chaos_bolt Fluffy_Pillow 703072.7/1100000: 64% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:39.253 conflagrate Fluffy_Pillow 722924.1/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:40.111 havoc enemy2 739492.7/1100000: 67% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:40.968 chaos_bolt Fluffy_Pillow 668042.0/1100000: 61% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:41.938 incinerate Fluffy_Pillow 682450.8/1100000: 62% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:42.819 incinerate Fluffy_Pillow 629537.5/1100000: 57% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:43.699 incinerate Fluffy_Pillow 576609.4/1100000: 52% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:44.580 conflagrate Fluffy_Pillow 523697.2/1100000: 48% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
0:45.539 incinerate Fluffy_Pillow 538149.0/1100000: 49% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
0:46.405 dimensional_rift Fluffy_Pillow 485199.4/1100000: 44% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
0:47.160 chaos_bolt Fluffy_Pillow 496577.0/1100000: 45% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
0:48.604 incinerate Fluffy_Pillow 517776.7/1100000: 47% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:49.497 dimensional_rift Fluffy_Pillow 464849.1/1100000: 42% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:50.251 incinerate Fluffy_Pillow 475886.8/1100000: 43% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:51.144 chaos_bolt Fluffy_Pillow 422959.2/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:52.036 incinerate Fluffy_Pillow 436017.1/1100000: 40% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:52.928 incinerate Fluffy_Pillow 383074.9/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
0:54.525 immolate Fluffy_Pillow 340453.0/1100000: 31% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
0:55.858 incinerate Fluffy_Pillow 293967.6/1100000: 27% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
0:57.432 dimensional_rift Fluffy_Pillow 251348.4/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
0:58.745 incinerate Fluffy_Pillow 270852.3/1100000: 25% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
1:00.318 havoc enemy2 227969.2/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, devils_due
1:01.667 chaos_bolt Fluffy_Pillow 159446.1/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:03.928 immolate Fluffy_Pillow 192930.1/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:05.042 conflagrate Fluffy_Pillow 143477.9/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:06.155 chaos_bolt Fluffy_Pillow 160010.9/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:07.493 conflagrate Fluffy_Pillow 179886.0/1100000: 16% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:08.607 chaos_bolt Fluffy_Pillow 196433.8/1100000: 18% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:09.944 conflagrate Fluffy_Pillow 216294.2/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:11.058 chaos_bolt Fluffy_Pillow 232842.0/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:12.395 conflagrate Fluffy_Pillow 252702.3/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:13.505 chaos_bolt Fluffy_Pillow 269239.8/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:14.822 incinerate Fluffy_Pillow 288282.3/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:16.178 chaos_bolt Fluffy_Pillow 242279.9/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:17.495 incinerate Fluffy_Pillow 262126.8/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:18.812 conflagrate Fluffy_Pillow 215973.6/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:19.910 chaos_bolt Fluffy_Pillow 232520.1/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:21.228 havoc enemy2 252659.4/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:22.312 incinerate Fluffy_Pillow 181228.7/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:23.613 incinerate Fluffy_Pillow 135114.9/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:24.912 dimensional_rift Fluffy_Pillow 88970.5/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:25.995 chaos_bolt Fluffy_Pillow 105524.5/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
1:28.157 immolate Fluffy_Pillow 137435.2/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:29.289 chaos_bolt Fluffy_Pillow 88006.4/1100000: 8% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:30.645 incinerate Fluffy_Pillow 107856.6/1100000: 10% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:32.002 dimensional_rift Fluffy_Pillow 61722.5/1100000: 6% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:33.115 chaos_bolt Fluffy_Pillow 78255.4/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:34.450 incinerate Fluffy_Pillow 98227.7/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:35.766 life_tap Fluffy_Pillow 52060.1/1100000: 5% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:36.849 immolate Fluffy_Pillow 398614.1/1100000: 36% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:37.934 conflagrate Fluffy_Pillow 349198.7/1100000: 32% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:39.018 conflagrate Fluffy_Pillow 365767.9/1100000: 33% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(4)
1:40.105 conflagrate Fluffy_Pillow 382356.4/1100000: 35% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
1:41.251 havoc enemy2 398885.7/1100000: 36% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
1:42.398 service_imp Fluffy_Pillow 327429.4/1100000: 30% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
1:43.530 chaos_bolt Fluffy_Pillow 343960.5/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
1:45.787 conflagrate Fluffy_Pillow 377000.3/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:46.919 chaos_bolt Fluffy_Pillow 393571.4/1100000: 36% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:48.275 incinerate Fluffy_Pillow 413422.5/1100000: 38% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:49.611 chaos_bolt Fluffy_Pillow 367267.9/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:50.491 incinerate Fluffy_Pillow 380340.7/1100000: 35% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:51.358 conflagrate Fluffy_Pillow 327407.0/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
1:52.112 chaos_bolt Fluffy_Pillow 338932.1/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:52.966 chaos_bolt Fluffy_Pillow 351985.7/1100000: 32% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:53.821 incinerate Fluffy_Pillow 365054.7/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:54.676 incinerate Fluffy_Pillow 312044.3/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:55.584 incinerate Fluffy_Pillow 259140.9/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact
1:56.491 incinerate Fluffy_Pillow 206224.1/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:57.383 incinerate Fluffy_Pillow 153281.9/1100000: 14% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:58.276 incinerate Fluffy_Pillow 100392.7/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, nefarious_pact, accelerando(2)
1:59.155 chaos_bolt Fluffy_Pillow 47518.2/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, nefarious_pact, accelerando(3)
2:00.599 immolate Fluffy_Pillow 69278.8/1100000: 6% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:01.353 chaos_bolt Fluffy_Pillow 14648.9/1100000: 1% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
2:02.204 life_tap Fluffy_Pillow 27656.7/1100000: 3% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(4)
2:03.480 havoc enemy2 377160.8/1100000: 34% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(4)
2:04.754 incinerate Fluffy_Pillow 308634.3/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(4)
2:06.284 incinerate Fluffy_Pillow 266020.8/1100000: 24% mana | 0.0/5: 0% soul_shard lord_of_flames, devils_due, accelerando(4)
2:07.816 soul_harvest Fluffy_Pillow 223439.2/1100000: 20% mana | 0.0/5: 0% soul_shard lord_of_flames, devils_due, accelerando(5)
2:07.816 potion Fluffy_Pillow 223439.2/1100000: 20% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, devils_due, accelerando(5)
2:07.816 incinerate Fluffy_Pillow 223439.2/1100000: 20% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, devils_due, accelerando(5), potion_of_deadly_grace
2:09.327 immolate Fluffy_Pillow 179954.7/1100000: 16% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, devils_due, potion_of_deadly_grace
2:10.678 conflagrate Fluffy_Pillow 133440.9/1100000: 12% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:11.827 conflagrate Fluffy_Pillow 150013.5/1100000: 14% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:12.957 chaos_bolt Fluffy_Pillow 166555.3/1100000: 15% mana | 4.0/5: 80% soul_shard soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:15.215 conflagrate Fluffy_Pillow 200095.7/1100000: 18% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:16.330 dimensional_rift Fluffy_Pillow 216658.3/1100000: 20% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:17.445 chaos_bolt Fluffy_Pillow 233221.0/1100000: 21% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:18.780 conflagrate Fluffy_Pillow 253051.6/1100000: 23% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:19.896 chaos_bolt Fluffy_Pillow 269629.1/1100000: 25% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:21.230 incinerate Fluffy_Pillow 289445.3/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:22.548 incinerate Fluffy_Pillow 243451.7/1100000: 22% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:23.848 havoc enemy2 197324.7/1100000: 18% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:24.996 conflagrate Fluffy_Pillow 125882.9/1100000: 11% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:26.144 chaos_bolt Fluffy_Pillow 142441.0/1100000: 13% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:28.434 incinerate Fluffy_Pillow 175526.0/1100000: 16% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:29.789 immolate enemy2 129361.5/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:30.921 chaos_bolt Fluffy_Pillow 79932.6/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:32.277 immolate Fluffy_Pillow 99782.9/1100000: 9% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:33.409 life_tap Fluffy_Pillow 50354.0/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:34.542 incinerate Fluffy_Pillow 396939.7/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:35.898 incinerate Fluffy_Pillow 350892.2/1100000: 32% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:37.233 incinerate Fluffy_Pillow 304723.4/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:38.551 chaos_bolt Fluffy_Pillow 258585.3/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:40.745 chaos_bolt Fluffy_Pillow 291281.8/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:42.121 incinerate Fluffy_Pillow 311128.6/1100000: 28% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:43.497 immolate Fluffy_Pillow 264975.3/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:44.643 havoc enemy2 215504.6/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:45.790 conflagrate Fluffy_Pillow 144048.4/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos
2:46.937 conflagrate Fluffy_Pillow 160592.1/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
2:48.076 chaos_bolt Fluffy_Pillow 177123.2/1100000: 16% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
2:50.336 conflagrate Fluffy_Pillow 210303.9/1100000: 19% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:51.445 chaos_bolt Fluffy_Pillow 226836.4/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:52.764 conflagrate Fluffy_Pillow 246713.3/1100000: 22% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:53.861 chaos_bolt Fluffy_Pillow 263244.8/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:55.179 incinerate Fluffy_Pillow 283106.7/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:56.496 incinerate Fluffy_Pillow 236953.5/1100000: 22% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:57.812 immolate enemy2 190785.2/1100000: 17% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
2:58.911 incinerate Fluffy_Pillow 141346.8/1100000: 13% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:00.229 conflagrate Fluffy_Pillow 94802.7/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando
3:01.359 dimensional_rift Fluffy_Pillow 111344.5/1100000: 10% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
3:02.490 chaos_bolt Fluffy_Pillow 127901.0/1100000: 12% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
3:04.749 havoc enemy2 160970.0/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando
3:05.880 immolate Fluffy_Pillow 89526.5/1100000: 8% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:07.012 berserking Fluffy_Pillow 40097.6/1100000: 4% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando
3:07.012 chaos_bolt Fluffy_Pillow 40097.6/1100000: 4% mana | 4.0/5: 80% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando
3:08.193 chaos_bolt Fluffy_Pillow 59980.6/1100000: 5% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:09.354 incinerate Fluffy_Pillow 79813.4/1100000: 7% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(2)
3:10.518 chaos_bolt Fluffy_Pillow 33920.4/1100000: 3% mana | 2.0/5: 40% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(3)
3:11.665 life_tap Fluffy_Pillow 53826.8/1100000: 5% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos, accelerando(4)
3:12.629 incinerate Fluffy_Pillow 400370.7/1100000: 36% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos
3:13.828 service_imp Fluffy_Pillow 354258.5/1100000: 32% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, embrace_chaos
3:14.827 incinerate Fluffy_Pillow 370829.0/1100000: 34% mana | 0.0/5: 0% soul_shard berserking, lord_of_flames, embrace_chaos
3:16.025 incinerate Fluffy_Pillow 324844.6/1100000: 30% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, accelerando
3:17.205 immolate Fluffy_Pillow 278285.6/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando
3:18.336 conflagrate Fluffy_Pillow 229037.2/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
3:19.450 chaos_bolt Fluffy_Pillow 245585.0/1100000: 22% mana | 4.0/5: 80% soul_shard lord_of_flames, accelerando(2)
3:21.676 conflagrate Fluffy_Pillow 278652.0/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:22.774 chaos_bolt Fluffy_Pillow 295198.5/1100000: 27% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:24.092 chaos_bolt Fluffy_Pillow 315060.4/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:25.408 havoc enemy2 334892.2/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:26.503 conflagrate Fluffy_Pillow 263440.7/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:27.595 conflagrate Fluffy_Pillow 280000.4/1100000: 25% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:28.739 chaos_bolt Fluffy_Pillow 296558.1/1100000: 27% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, accelerando
3:30.096 chaos_bolt Fluffy_Pillow 316423.0/1100000: 29% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:31.453 incinerate Fluffy_Pillow 336288.9/1100000: 31% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:32.793 conflagrate Fluffy_Pillow 290193.8/1100000: 26% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:33.908 incinerate Fluffy_Pillow 306756.5/1100000: 28% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:35.243 chaos_bolt Fluffy_Pillow 260588.8/1100000: 24% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:36.561 incinerate Fluffy_Pillow 280450.7/1100000: 25% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:37.878 chaos_bolt Fluffy_Pillow 234297.5/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:39.194 incinerate Fluffy_Pillow 254129.2/1100000: 23% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:40.512 immolate Fluffy_Pillow 207965.9/1100000: 19% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:41.660 chaos_bolt Fluffy_Pillow 158525.2/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:43.016 incinerate Fluffy_Pillow 178376.2/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:44.353 incinerate Fluffy_Pillow 132236.6/1100000: 12% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:45.689 incinerate Fluffy_Pillow 86082.0/1100000: 8% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
3:47.027 dimensional_rift Fluffy_Pillow 39957.2/1100000: 4% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
3:48.142 life_tap Fluffy_Pillow 56519.9/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(2)
3:49.243 havoc enemy2 403050.1/1100000: 37% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
3:50.340 immolate Fluffy_Pillow 331581.5/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
3:51.440 conflagrate Fluffy_Pillow 282158.2/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
3:52.537 chaos_bolt Fluffy_Pillow 298689.7/1100000: 27% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
3:54.731 conflagrate Fluffy_Pillow 331057.3/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
3:55.877 summon_doomguard Fluffy_Pillow 347586.6/1100000: 32% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:57.024 conflagrate Fluffy_Pillow 364130.3/1100000: 33% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:58.153 chaos_bolt Fluffy_Pillow 380657.6/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:59.510 conflagrate Fluffy_Pillow 400523.5/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
4:00.625 chaos_bolt Fluffy_Pillow 417086.1/1100000: 38% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:01.960 chaos_bolt Fluffy_Pillow 436916.8/1100000: 40% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:03.298 incinerate Fluffy_Pillow 456791.9/1100000: 42% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:04.635 incinerate Fluffy_Pillow 410652.3/1100000: 37% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:05.971 conflagrate Fluffy_Pillow 364498.6/1100000: 33% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:07.071 incinerate Fluffy_Pillow 381075.3/1100000: 35% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:08.389 soul_harvest Fluffy_Pillow 334938.3/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(4)
4:08.389 incinerate Fluffy_Pillow 334938.3/1100000: 30% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:09.689 havoc enemy2 288237.1/1100000: 26% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
4:10.817 incinerate Fluffy_Pillow 216808.1/1100000: 20% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:12.154 dimensional_rift Fluffy_Pillow 170668.4/1100000: 16% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:13.270 immolate Fluffy_Pillow 187246.0/1100000: 17% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:14.384 incinerate Fluffy_Pillow 137794.6/1100000: 13% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:15.701 incinerate Fluffy_Pillow 91641.4/1100000: 8% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:17.018 life_tap Fluffy_Pillow 45488.2/1100000: 4% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:18.117 incinerate Fluffy_Pillow 392049.8/1100000: 36% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:19.434 incinerate Fluffy_Pillow 345944.5/1100000: 31% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:20.733 incinerate Fluffy_Pillow 299800.1/1100000: 27% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:22.033 incinerate Fluffy_Pillow 253437.8/1100000: 23% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:23.407 immolate Fluffy_Pillow 207255.7/1100000: 19% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:24.556 conflagrate Fluffy_Pillow 157828.3/1100000: 14% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:25.704 conflagrate Fluffy_Pillow 174386.5/1100000: 16% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames
4:26.852 chaos_bolt Fluffy_Pillow 190944.7/1100000: 17% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:29.145 conflagrate Fluffy_Pillow 224242.3/1100000: 20% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:30.275 havoc enemy2 240784.1/1100000: 22% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:31.405 dimensional_rift Fluffy_Pillow 169326.0/1100000: 15% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:32.535 chaos_bolt Fluffy_Pillow 185867.8/1100000: 17% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:33.890 chaos_bolt Fluffy_Pillow 205704.1/1100000: 19% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:35.227 conflagrate Fluffy_Pillow 225564.4/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:36.340 chaos_bolt Fluffy_Pillow 242097.3/1100000: 22% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:37.677 incinerate Fluffy_Pillow 262084.9/1100000: 24% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:38.994 conflagrate Fluffy_Pillow 215931.7/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:40.260 chaos_bolt Fluffy_Pillow 234907.9/1100000: 21% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:41.635 incinerate Fluffy_Pillow 254740.2/1100000: 23% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:43.013 incinerate Fluffy_Pillow 208615.7/1100000: 19% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:44.390 service_imp Fluffy_Pillow 162476.9/1100000: 15% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:45.539 incinerate Fluffy_Pillow 179049.5/1100000: 16% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:46.916 immolate Fluffy_Pillow 132910.6/1100000: 12% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos
4:48.063 conflagrate Fluffy_Pillow 83478.7/1100000: 8% mana | 0.0/5: 0% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:49.195 incinerate Fluffy_Pillow 100049.8/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:50.551 life_tap Fluffy_Pillow 53900.0/1100000: 5% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:51.683 havoc enemy2 400471.2/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando
4:52.810 conflagrate Fluffy_Pillow 329021.5/1100000: 30% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:53.950 chaos_bolt Fluffy_Pillow 345955.5/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
4:56.175 incinerate Fluffy_Pillow 379305.2/1100000: 34% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:57.491 incinerate Fluffy_Pillow 333136.9/1100000: 30% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:58.809 incinerate Fluffy_Pillow 286998.8/1100000: 26% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 53301 53301 34742
Intellect 50545 48839 39190 (1278)
Spirit 1 1 0
Health 3198060 3198060 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50545 48839 0
Crit 13.94% 13.94% 3577
Haste 31.12% 30.12% 11296
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14423 14313 0
Mastery 68.22% 68.22% 5896
Armor 1981 1981 1981
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Feretory of Souls
ilevel: 940, stats: { 202 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Feretory_RB"
level=110
race=troll
role=spell
position=back
talents=2203021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=feretory_of_souls,id=132456,ilevel=940
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=907.27
# gear_stamina=34742
# gear_intellect=39190
# gear_crit_rating=3577
# gear_haste_rating=11296
# gear_mastery_rating=5896
# gear_versatility_rating=2829
# gear_armor=1981
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Lessons_of_Space-Time : 976275 dps, 564918 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
976274.7 976274.7 619.2 / 0.063% 122982.8 / 12.6% 30.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
26095.4 26095.4 Mana 0.00% 52.1 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Lessons_of_Space-Time 976275
Chaos Bolt 296237 30.4% 58.7 4.98sec 1517553 1032577 Direct 113.1 0 787932 787932 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.72 113.09 0.00 0.00 1.4697 0.0000 89110353.26 89110353.26 0.00 1032576.89 1032576.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 113.09 100.00% 787932.06 517406 1138014 788224.86 749487 840639 89110353 89110353 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 109145 11.2% 49.2 6.11sec 667127 654790 Direct 98.3 197847 444516 333688 55.1%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.17 98.30 0.00 0.00 1.0188 0.0000 32801708.51 32801708.51 0.00 654790.07 654790.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.16 44.93% 197847.32 130630 287311 197905.09 172084 223155 8737757 8737757 0.00
crit 54.13 55.07% 444515.83 261312 654743 444602.12 402971 482685 24063951 24063951 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 13848 1.4% 33.3 4.96sec 123022 0 Direct 33.3 108047 216102 123021 13.9%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.26 33.26 0.00 0.00 0.0000 0.0000 4091391.23 4091391.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.65 86.14% 108046.95 86944 114766 108043.33 103289 112271 3095326 3095326 0.00
crit 4.61 13.86% 216102.24 173888 229532 214125.20 0 229532 996066 996066 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 248928 25.5% 20.2 15.07sec 3707036 3586736 Direct 39.0 135288 270540 197521 46.0%  
Periodic 303.1 151719 303210 221403 46.0% 196.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.18 39.04 303.07 303.07 1.0336 1.9540 74812132.27 74812132.27 0.00 122032.08 3586735.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.08 53.99% 135288.01 90629 199322 135253.69 117021 152985 2851464 2851464 0.00
crit 17.96 46.01% 270540.07 181254 398632 270464.95 227486 312884 4859700 4859700 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 163.7 54.00% 151718.86 90 426125 151884.23 132540 175632 24830458 24830458 0.00
crit 139.4 46.00% 303210.30 153 961535 303609.70 261195 358565 42270510 42270510 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 127876 13.1% 78.8 3.64sec 488900 410663 Direct 151.7 222801 445543 253912 14.0%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.78 151.69 0.00 0.00 1.1905 0.0000 38516491.01 38516491.01 0.00 410662.97 410662.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.51 86.03% 222801.49 146517 322221 222785.13 207988 236762 29076856 29076856 0.00
crit 21.19 13.97% 445542.60 293070 644431 445524.91 382164 515065 9439635 9439635 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9716 1.0% 20.3 14.68sec 143673 0 Direct 20.3 126143 252102 143674 13.9%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.34 20.34 0.00 0.00 0.0000 0.0000 2922639.88 2922639.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.51 86.08% 126143.20 110880 146362 126157.79 119504 135104 2208902 2208902 0.00
crit 2.83 13.92% 252102.39 221761 292724 237588.39 0 292724 713738 713738 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 42112 / 42112
Firebolt 42112 4.3% 110.7 2.72sec 114422 93491 Direct 109.8 101206 202384 115312 13.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.67 109.81 0.00 0.00 1.2239 0.0000 12662784.06 12662784.06 0.00 93490.92 93490.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 94.50 86.06% 101206.18 65421 117757 101210.85 99164 103119 9564181 9564181 0.00
crit 15.31 13.94% 202384.40 130842 235515 202383.11 179907 225702 3098603 3098603 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 120173 / 38245
Firebolt 120173 3.9% 49.2 5.52sec 232907 201548 Direct 49.0 205672 411261 234185 13.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.24 48.97 0.00 0.00 1.1556 0.0000 11468707.63 11468707.63 0.00 201548.38 201548.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.18 86.13% 205671.90 130842 235515 205825.21 200092 212723 8675360 8675360 0.00
crit 6.79 13.87% 411261.00 261683 471029 411074.49 0 471029 2793348 2793348 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 107854 / 9127
Immolation 83010 0.7% 1.0 0.00sec 2075340 0 Periodic 45.4 40130 80270 45704 13.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.70 45.41 0.0000 1.0813 2075340.01 2075340.01 0.00 84538.68 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.1 86.11% 40130.09 34650 41580 40131.65 39448 41018 1569205 1569205 0.00
crit 6.3 13.89% 80270.14 69300 83160 80147.30 0 83160 506135 506135 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24844 0.2% 22.7 1.09sec 27357 25301 Direct 22.7 23999 47983 27357 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.70 22.70 0.00 0.00 1.0813 0.0000 621123.78 913110.79 31.98 25301.39 25301.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.53 86.00% 23999.46 20721 24865 24000.77 23385 24865 468600 688887 31.98
crit 3.18 14.00% 47982.68 41442 49730 46413.75 0 49730 152523 224224 30.92
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 94897 / 8020
Doom Bolt 94897 0.8% 11.0 2.21sec 215604 97574 Direct 11.0 189168 378481 215617 14.0%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.00 11.00 0.00 0.00 2.2097 0.0000 2372507.41 2372507.41 0.00 97573.82 97573.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.47 86.03% 189168.39 182954 219545 189177.51 182954 219545 1790699 1790699 0.00
crit 1.54 13.97% 378481.01 365908 439090 305437.14 0 439090 581808 581808 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 107883 / 9130
Immolation 83030 0.7% 1.0 0.00sec 2075834 0 Periodic 45.4 40132 80243 45715 13.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.70 45.41 0.0000 1.0813 2075834.17 2075834.17 0.00 84558.81 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.1 86.08% 40132.29 34650 41580 40134.30 39480 41018 1568711 1568711 0.00
crit 6.3 13.92% 80242.92 69300 83160 80146.59 0 83160 507124 507124 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24853 0.2% 22.7 1.09sec 27368 25311 Direct 22.7 23998 48003 27368 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.70 22.70 0.00 0.00 1.0813 0.0000 621358.36 913455.65 31.98 25310.94 25310.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.52 85.96% 23997.80 20721 24865 23998.96 23385 24865 468366 688542 31.98
crit 3.19 14.04% 48003.14 41442 49730 46368.68 0 49730 152993 224914 30.89
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 107828 / 9125
Immolation 83005 0.7% 1.0 0.00sec 2075210 0 Periodic 45.4 40129 80278 45701 13.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.70 45.41 0.0000 1.0813 2075209.71 2075209.71 0.00 84533.37 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.1 86.12% 40129.47 34650 41580 40131.43 39402 40986 1569335 1569335 0.00
crit 6.3 13.88% 80277.86 69300 83160 80181.08 0 83160 505875 505875 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24823 0.2% 22.7 1.09sec 27334 25280 Direct 22.7 23998 48003 27335 13.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.70 22.70 0.00 0.00 1.0813 0.0000 620594.51 912332.72 31.98 25279.83 25279.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.55 86.10% 23997.78 20721 24865 23998.97 23385 24865 469130 689665 31.98
crit 3.16 13.90% 48003.35 41442 49730 46408.54 0 49730 151465 222668 30.91
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 107831 / 9125
Immolation 82991 0.7% 1.0 0.00sec 2074858 0 Periodic 45.4 40127 80314 45693 13.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.70 45.41 0.0000 1.0813 2074857.63 2074857.63 0.00 84519.03 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.1 86.15% 40126.56 34650 41580 40128.46 39204 41018 1569687 1569687 0.00
crit 6.3 13.85% 80314.13 69300 83160 80269.26 0 83160 505171 505171 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24840 0.2% 22.7 1.09sec 27353 25297 Direct 22.7 23997 48013 27353 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.70 22.70 0.00 0.00 1.0813 0.0000 621020.16 912958.46 31.98 25297.17 25297.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.53 86.03% 23997.03 20721 24865 23998.32 23311 24865 468704 689039 31.98
crit 3.17 13.97% 48012.59 41442 49730 46598.96 0 49730 152316 223919 31.02
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 113777 / 19390
Shadow Bolt 113777 2.0% 4.4 59.15sec 1322680 0 Periodic 46.7 109079 217994 124348 14.0% 19.8%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.39 0.00 46.94 46.68 0.0000 1.2710 5803935.49 5803935.49 0.00 97283.53 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.1 85.98% 109078.99 70 127940 108925.04 0 127940 4377523 4377523 0.00
crit 6.5 14.02% 217994.12 223 255880 214639.89 0 255880 1426413 1426413 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 134451 / 9280
Chaos Bolt 134451 0.9% 4.4 58.83sec 637710 312962 Direct 4.3 0 642054 642054 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 4.33 0.00 0.00 2.0378 0.0000 2783168.78 2783168.78 0.00 312961.74 312961.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.33 100.00% 642054.44 607406 728887 642343.43 0 728887 2783169 2783169 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 229921 / 17292
Chaos Barrage 229921 1.8% 4.4 60.21sec 1180513 0 Periodic 147.2 30858 61714 35161 13.9% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.39 0.00 147.99 147.24 0.0000 0.1608 5177287.41 5177287.41 0.00 217560.51 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 126.7 86.05% 30857.56 155 35184 30788.49 0 35184 3909987 3909987 0.00
crit 20.5 13.95% 61713.76 310 70369 61552.03 0 70369 1267301 1267301 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Lessons_of_Space-Time
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lessons_of_Space-Time
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.97sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.1 23.44sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.07 0.00 0.00 0.00 0.9878 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lessons_of_Space-Time
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Lessons_of_Space-Time
  • harmful:false
  • if_expr:
 
Havoc 15.1 20.66sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.07 0.00 0.00 0.00 1.0481 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.3 20.41sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.28 0.00 0.00 0.00 0.9805 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 92.14sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.66 0.00 0.00 0.00 0.9574 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.13sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0629 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7527 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.47% 78.47% 1.4(1.4) 19.3

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.72%
  • accelerando_2:24.56%
  • accelerando_3:14.69%
  • accelerando_4:6.56%
  • accelerando_5:2.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 181.0sec 181.0sec 6.84% 7.40% 0.0(0.0) 2.0

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.61% 0.0(0.0) 1.0

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.6 0.0 12.1sec 12.1sec 49.29% 47.81% 0.0(0.0) 0.5

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.29%

Trigger Attempt Success

  • trigger_pct:49.94%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.4sec 69.4sec 8.72% 8.72% 0.0(0.0) 3.2

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.0 33.7 11.8sec 5.0sec 59.97% 67.90% 33.7(33.7) 25.3

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 6.7 8.6 46.1sec 20.4sec 98.13% 96.64% 47.8(47.8) 5.7

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:98.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.92% 97.92% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.7sec 69.0sec 13.57% 13.57% 0.0(0.0) 3.3

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.57%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 128.1sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 121.1sec 121.1sec 17.75% 17.75% 0.0(0.0) 2.7

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.4 59.4sec
chaos_tear 4.4 59.2sec
chaos_portal 4.4 59.1sec
dimension_ripper 3.9 54.5sec

Resources

Resource Usage Type Count Total Average RPE APR
Lessons_of_Space-Time
chaos_bolt Soul Shard 59.7 119.4 2.0 2.0 746096.9
havoc Mana 15.1 1326131.8 88000.0 87999.8 0.0
immolate Mana 20.2 1331949.0 66000.0 65999.8 56.2
incinerate Mana 78.8 5199754.9 66000.0 66001.9 7.4
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 110.7 4426.7 40.0 40.0 2860.6
pet - service_imp
firebolt Energy 49.2 1969.7 40.0 40.0 5822.5
pet - doomguard
doom_bolt Energy 11.0 385.1 35.0 35.0 6160.1
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.28 3631935.21 (47.05%) 237694.96 1410404.09 27.97%
immolate Soul Shard 66.56 65.82 (53.16%) 0.99 0.74 1.11%
conflagrate Soul Shard 49.17 49.10 (39.66%) 1.00 0.07 0.14%
mp5_regen Mana 489.85 4088100.84 (52.95%) 8345.65 626842.01 13.29%
soulsnatcher Soul Shard 8.89 8.89 (7.18%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1874.98 4260.57 (100.00%) 2.27 22.81 0.53%
pet - service_imp
energy_regen Energy 432.29 1367.25 (100.00%) 3.16 63.79 4.46%
pet - doomguard
energy_regen Energy 11.00 350.06 (100.00%) 31.81 45.58 11.52%
Resource RPS-Gain RPS-Loss
Health 0.00 16194.03
Mana 25637.77 26095.39
Soul Shard 0.41 0.42
Combat End Resource Mean Min Max
Mana 961470.09 325914.94 1100000.00
Soul Shard 1.73 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 12.3%

Statistics & Data Analysis

Fight Length
Sample Data Lessons_of_Space-Time Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Lessons_of_Space-Time Damage Per Second
Count 9999
Mean 976274.67
Minimum 878753.65
Maximum 1105745.76
Spread ( max - min ) 226992.11
Range [ ( max - min ) / 2 * 100% ] 11.63%
Standard Deviation 31590.5420
5th Percentile 926571.79
95th Percentile 1029953.98
( 95th Percentile - 5th Percentile ) 103382.19
Mean Distribution
Standard Deviation 315.9212
95.00% Confidence Intervall ( 975655.48 - 976893.87 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4023
0.1 Scale Factor Error with Delta=300 8519181
0.05 Scale Factor Error with Delta=300 34076723
0.01 Scale Factor Error with Delta=300 851918054
Priority Target DPS
Sample Data Lessons_of_Space-Time Priority Target Damage Per Second
Count 9999
Mean 564918.28
Minimum 503852.04
Maximum 646778.59
Spread ( max - min ) 142926.55
Range [ ( max - min ) / 2 * 100% ] 12.65%
Standard Deviation 18912.4069
5th Percentile 534948.36
95th Percentile 597118.32
( 95th Percentile - 5th Percentile ) 62169.95
Mean Distribution
Standard Deviation 189.1335
95.00% Confidence Intervall ( 564547.59 - 565288.98 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4306
0.1 Scale Factor Error with Delta=300 3053355
0.05 Scale Factor Error with Delta=300 12213420
0.01 Scale Factor Error with Delta=300 305335482
DPS(e)
Sample Data Lessons_of_Space-Time Damage Per Second (Effective)
Count 9999
Mean 976274.67
Minimum 878753.65
Maximum 1105745.76
Spread ( max - min ) 226992.11
Range [ ( max - min ) / 2 * 100% ] 11.63%
Damage
Sample Data Lessons_of_Space-Time Damage
Count 9999
Mean 242254716.17
Minimum 169514531.61
Maximum 318494422.10
Spread ( max - min ) 148979890.49
Range [ ( max - min ) / 2 * 100% ] 30.75%
DTPS
Sample Data Lessons_of_Space-Time Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Lessons_of_Space-Time Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Lessons_of_Space-Time Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Lessons_of_Space-Time Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Lessons_of_Space-Time Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Lessons_of_Space-Time Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Lessons_of_Space-TimeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Lessons_of_Space-Time Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 15.07 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.22 immolate,if=remains<=tick_time
F 0.65 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.34 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 14.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 35.18 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
L 14.28 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
M 3.66 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.89 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 12.07 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 59.02 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 79.11 incinerate
0.00 life_tap

Sample Sequence

01269ABCDEGHJKMKNPQKQRRSKRSSSKRLCSRSSERSSSSGJRKKRKRLCSSKRQRKRSESRSSLRCSSRSSSSRGJKRKRKRLRCKRSQSREQSSSMSLRCGJRRKRKRKRSSKLRCSSEPISSSSSSQGJKLRCRKKRSRKSRSRSLESSSCRRSSSRGJKRKRSKLQRCHMKRRRSESSSQSLGJKRCKRKRSSSKRSSLSSQSEQSCSRSSGJKOLRKRKRCPSRKRSSRSSERRLSSSSSSCGJQRJJJMRLRRSSJRSRSCSJERSJR

Sample Sequence Table

time name target resources buffs
Pre flask Lessons_of_Space-Time 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Lessons_of_Space-Time 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Lessons_of_Space-Time 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.094 dimensional_rift Fluffy_Pillow 1032972.8/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.958 immolate Fluffy_Pillow 1049536.4/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.824 immolate Fluffy_Pillow 1000138.3/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.689 berserking Fluffy_Pillow 950721.0/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.689 conflagrate Fluffy_Pillow 950721.0/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:04.444 conflagrate Fluffy_Pillow 967366.0/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando, potion_of_deadly_grace
0:05.199 service_imp Fluffy_Pillow 984011.0/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, accelerando, potion_of_deadly_grace
0:05.955 conflagrate Fluffy_Pillow 1000678.1/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, accelerando, potion_of_deadly_grace
0:06.698 summon_infernal Fluffy_Pillow 1017298.0/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:07.452 soul_harvest Fluffy_Pillow 1034164.0/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:07.452 dimensional_rift Fluffy_Pillow 1034164.0/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:08.207 conflagrate Fluffy_Pillow 1051052.4/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:08.962 dimensional_rift Fluffy_Pillow 1067940.8/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:09.718 chaos_bolt Fluffy_Pillow 1084851.5/1100000: 99% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:11.195 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:12.071 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:12.987 conflagrate Fluffy_Pillow 1034108.6/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:13.754 chaos_bolt Fluffy_Pillow 1050708.6/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:14.790 incinerate Fluffy_Pillow 1070569.6/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:15.827 incinerate Fluffy_Pillow 1024449.7/1100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:16.863 incinerate Fluffy_Pillow 978310.6/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:17.898 conflagrate Fluffy_Pillow 932153.2/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:18.751 chaos_bolt Fluffy_Pillow 948744.9/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:19.773 life_tap Fluffy_Pillow 968623.9/1100000: 88% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:20.625 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:21.477 incinerate Fluffy_Pillow 1028572.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:22.497 chaos_bolt Fluffy_Pillow 982412.4/1100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:23.517 incinerate Fluffy_Pillow 1002281.0/1100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:24.524 incinerate Fluffy_Pillow 956150.1/1100000: 87% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:25.530 immolate Fluffy_Pillow 909863.3/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:26.407 chaos_bolt Fluffy_Pillow 860430.6/1100000: 78% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:27.459 incinerate Fluffy_Pillow 880303.8/1100000: 80% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:28.511 incinerate Fluffy_Pillow 834177.0/1100000: 76% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:29.562 incinerate Fluffy_Pillow 788031.3/1100000: 72% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:30.615 incinerate Fluffy_Pillow 741923.4/1100000: 67% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:31.668 immolate Fluffy_Pillow 695816.9/1100000: 63% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando
0:32.533 conflagrate Fluffy_Pillow 646399.6/1100000: 59% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando
0:33.398 chaos_bolt Fluffy_Pillow 662982.3/1100000: 60% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
0:35.126 conflagrate Fluffy_Pillow 696109.4/1100000: 63% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:35.990 conflagrate Fluffy_Pillow 712672.9/1100000: 65% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:36.854 chaos_bolt Fluffy_Pillow 729236.5/1100000: 66% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:37.891 conflagrate Fluffy_Pillow 749116.6/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:38.944 chaos_bolt Fluffy_Pillow 769303.4/1100000: 70% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:39.982 life_tap Fluffy_Pillow 789202.7/1100000: 72% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:40.847 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:41.923 incinerate Fluffy_Pillow 1027867.5/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:43.270 incinerate Fluffy_Pillow 981935.1/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:44.597 conflagrate Fluffy_Pillow 935387.7/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:45.737 chaos_bolt Fluffy_Pillow 951953.5/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:48.010 dimensional_rift Fluffy_Pillow 985239.3/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:49.132 chaos_bolt Fluffy_Pillow 1001798.7/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:50.460 conflagrate Fluffy_Pillow 1021668.7/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:51.737 chaos_bolt Fluffy_Pillow 1040775.6/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:53.065 incinerate Fluffy_Pillow 1060646.7/1100000: 96% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:54.375 immolate Fluffy_Pillow 1014529.4/1100000: 92% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:55.466 incinerate Fluffy_Pillow 965088.2/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:56.775 chaos_bolt Fluffy_Pillow 918955.8/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:58.083 incinerate Fluffy_Pillow 938808.1/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
0:58.946 incinerate Fluffy_Pillow 885827.6/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:59.833 life_tap Fluffy_Pillow 832908.0/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:00.587 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:01.475 havoc enemy2 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:02.229 incinerate Fluffy_Pillow 1023281.6/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:03.102 incinerate Fluffy_Pillow 970378.0/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:03.963 chaos_bolt Fluffy_Pillow 917445.9/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:04.822 incinerate Fluffy_Pillow 930483.5/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:05.682 incinerate Fluffy_Pillow 877536.3/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:06.544 incinerate Fluffy_Pillow 824619.5/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:07.407 incinerate Fluffy_Pillow 771717.8/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:08.268 chaos_bolt Fluffy_Pillow 718852.1/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
1:09.116 immolate Fluffy_Pillow 731906.5/1100000: 67% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
1:09.868 conflagrate Fluffy_Pillow 677644.1/1100000: 62% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(5)
1:11.131 conflagrate Fluffy_Pillow 697152.0/1100000: 63% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:12.473 chaos_bolt Fluffy_Pillow 716653.2/1100000: 65% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:14.084 conflagrate Fluffy_Pillow 740239.0/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
1:15.402 chaos_bolt Fluffy_Pillow 759708.0/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:16.964 conflagrate Fluffy_Pillow 783299.0/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:18.250 chaos_bolt Fluffy_Pillow 802817.5/1100000: 73% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:19.560 life_tap Fluffy_Pillow 822700.2/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:20.652 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:21.961 havoc enemy2 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
1:23.023 conflagrate Fluffy_Pillow 1028576.3/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
1:24.085 chaos_bolt Fluffy_Pillow 1045152.6/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
1:25.356 incinerate Fluffy_Pillow 1064896.3/1100000: 97% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:26.724 dimensional_rift Fluffy_Pillow 1018775.3/1100000: 93% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:27.863 incinerate Fluffy_Pillow 1035326.6/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:29.229 chaos_bolt Fluffy_Pillow 989176.5/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:30.596 immolate Fluffy_Pillow 1009042.1/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:31.718 dimensional_rift Fluffy_Pillow 959742.3/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:32.825 incinerate Fluffy_Pillow 976305.6/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:34.153 incinerate Fluffy_Pillow 930175.6/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:35.481 incinerate Fluffy_Pillow 884045.6/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:36.807 service_imp Fluffy_Pillow 837885.7/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:37.913 incinerate Fluffy_Pillow 854434.1/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:39.239 life_tap Fluffy_Pillow 808274.1/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:40.346 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:42.555 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
1:43.691 immolate Fluffy_Pillow 1028538.7/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:44.830 conflagrate Fluffy_Pillow 979090.1/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:45.956 chaos_bolt Fluffy_Pillow 995616.9/1100000: 91% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:47.302 chaos_bolt Fluffy_Pillow 1015466.1/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:48.647 conflagrate Fluffy_Pillow 1035300.4/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:49.771 chaos_bolt Fluffy_Pillow 1051875.8/1100000: 96% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:51.119 conflagrate Fluffy_Pillow 1071754.4/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:52.236 chaos_bolt Fluffy_Pillow 1088291.6/1100000: 99% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:53.564 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:54.670 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:55.998 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:57.326 incinerate Fluffy_Pillow 1034072.7/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:58.692 conflagrate Fluffy_Pillow 987922.6/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:59.832 life_tap Fluffy_Pillow 1004488.4/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:00.969 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:03.210 havoc enemy2 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:04.315 incinerate Fluffy_Pillow 1028533.4/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:05.643 incinerate Fluffy_Pillow 982478.1/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:06.952 immolate Fluffy_Pillow 936346.7/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
2:08.028 soul_harvest Fluffy_Pillow 886909.9/1100000: 81% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
2:08.028 potion Fluffy_Pillow 886909.9/1100000: 81% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4)
2:08.028 incinerate Fluffy_Pillow 886909.9/1100000: 81% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4), potion_of_deadly_grace
2:09.320 incinerate Fluffy_Pillow 840798.0/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4), potion_of_deadly_grace
2:10.609 incinerate Fluffy_Pillow 794639.9/1100000: 72% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(4), potion_of_deadly_grace
2:11.901 incinerate Fluffy_Pillow 748529.2/1100000: 68% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(5), potion_of_deadly_grace
2:13.174 incinerate Fluffy_Pillow 702018.7/1100000: 64% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
2:14.540 incinerate Fluffy_Pillow 655868.7/1100000: 60% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
2:15.905 dimensional_rift Fluffy_Pillow 609704.1/1100000: 55% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
2:17.235 immolate Fluffy_Pillow 629030.9/1100000: 57% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
2:18.374 conflagrate Fluffy_Pillow 579583.1/1100000: 53% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:19.495 conflagrate Fluffy_Pillow 596114.2/1100000: 54% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:20.618 life_tap Fluffy_Pillow 612674.8/1100000: 56% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:21.734 chaos_bolt Fluffy_Pillow 959247.3/1100000: 87% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:23.943 havoc enemy2 992299.1/1100000: 90% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:25.050 chaos_bolt Fluffy_Pillow 920862.4/1100000: 84% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:26.379 conflagrate Fluffy_Pillow 940747.4/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:27.486 conflagrate Fluffy_Pillow 957310.7/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:28.580 chaos_bolt Fluffy_Pillow 973844.2/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:29.888 incinerate Fluffy_Pillow 993696.6/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:31.196 chaos_bolt Fluffy_Pillow 947015.2/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:32.563 conflagrate Fluffy_Pillow 966879.6/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:33.703 incinerate Fluffy_Pillow 983445.5/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:35.070 chaos_bolt Fluffy_Pillow 937310.0/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:36.437 incinerate Fluffy_Pillow 957175.5/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:37.783 chaos_bolt Fluffy_Pillow 911024.6/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:39.128 incinerate Fluffy_Pillow 930859.0/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:40.015 life_tap Fluffy_Pillow 877939.4/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:40.771 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:41.526 incinerate Fluffy_Pillow 1034294.9/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:42.413 incinerate Fluffy_Pillow 981513.9/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:43.287 incinerate Fluffy_Pillow 928591.0/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
2:44.161 havoc enemy2 875668.1/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
2:44.916 chaos_bolt Fluffy_Pillow 798964.7/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
2:46.368 chaos_bolt Fluffy_Pillow 820690.0/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:47.242 incinerate Fluffy_Pillow 833768.2/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:48.103 incinerate Fluffy_Pillow 780836.1/1100000: 71% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:48.964 incinerate Fluffy_Pillow 727560.3/1100000: 66% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
2:49.864 chaos_bolt Fluffy_Pillow 674639.7/1100000: 61% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:50.752 immolate Fluffy_Pillow 687734.8/1100000: 63% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:51.507 conflagrate Fluffy_Pillow 632868.6/1100000: 58% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando
2:52.816 conflagrate Fluffy_Pillow 652357.5/1100000: 59% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
2:54.101 chaos_bolt Fluffy_Pillow 671860.8/1100000: 61% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(3)
2:55.643 conflagrate Fluffy_Pillow 695264.7/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(3)
2:56.927 chaos_bolt Fluffy_Pillow 714752.8/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
2:58.468 incinerate Fluffy_Pillow 738142.7/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(4)
2:59.988 conflagrate Fluffy_Pillow 695540.4/1100000: 63% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:01.063 life_tap Fluffy_Pillow 712088.2/1100000: 65% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:02.155 dimensional_rift Fluffy_Pillow 1058642.5/1100000: 96% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:03.295 chaos_bolt Fluffy_Pillow 1075208.3/1100000: 98% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:05.570 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:06.709 berserking Fluffy_Pillow 1028551.3/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:06.709 service_imp Fluffy_Pillow 1028551.3/1100000: 94% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:07.799 conflagrate Fluffy_Pillow 1046766.5/1100000: 95% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:08.773 chaos_bolt Fluffy_Pillow 1063346.3/1100000: 97% mana | 4.0/5: 80% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:09.928 chaos_bolt Fluffy_Pillow 1083220.0/1100000: 98% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:11.083 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:12.238 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:13.394 immolate Fluffy_Pillow 1034103.2/1100000: 94% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:14.357 incinerate Fluffy_Pillow 984689.6/1100000: 90% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:15.495 incinerate Fluffy_Pillow 938552.6/1100000: 85% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:16.634 incinerate Fluffy_Pillow 892433.1/1100000: 81% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:17.773 dimensional_rift Fluffy_Pillow 843891.2/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:18.864 incinerate Fluffy_Pillow 860450.0/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:20.174 life_tap Fluffy_Pillow 814090.4/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:21.313 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:22.453 conflagrate Fluffy_Pillow 1034072.7/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:23.594 conflagrate Fluffy_Pillow 1050653.0/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
3:24.732 chaos_bolt Fluffy_Pillow 1067189.8/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
3:27.006 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:28.128 conflagrate Fluffy_Pillow 1028545.8/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:29.250 chaos_bolt Fluffy_Pillow 1045091.7/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:30.596 conflagrate Fluffy_Pillow 1065039.3/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:31.703 chaos_bolt Fluffy_Pillow 1081602.7/1100000: 98% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:33.030 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:34.357 incinerate Fluffy_Pillow 1034059.8/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:35.686 incinerate Fluffy_Pillow 987944.8/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:37.012 conflagrate Fluffy_Pillow 941784.9/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:37.770 chaos_bolt Fluffy_Pillow 953081.1/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
3:39.266 incinerate Fluffy_Pillow 974820.1/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:40.164 incinerate Fluffy_Pillow 921869.4/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:41.062 life_tap Fluffy_Pillow 868918.6/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:41.816 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:42.715 incinerate Fluffy_Pillow 1034059.0/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:43.601 dimensional_rift Fluffy_Pillow 981124.6/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:44.355 incinerate Fluffy_Pillow 992243.7/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:45.243 immolate Fluffy_Pillow 939338.8/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:45.997 dimensional_rift Fluffy_Pillow 884457.8/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:46.851 incinerate Fluffy_Pillow 897051.5/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:47.739 havoc enemy2 844146.6/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:48.493 incinerate Fluffy_Pillow 767265.7/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:49.380 chaos_bolt Fluffy_Pillow 714347.1/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
3:51.980 incinerate Fluffy_Pillow 753249.2/1100000: 68% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
3:53.543 incinerate Fluffy_Pillow 710636.2/1100000: 65% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
3:55.085 immolate Fluffy_Pillow 667798.5/1100000: 61% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
3:56.427 conflagrate Fluffy_Pillow 621299.7/1100000: 56% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due
3:57.768 conflagrate Fluffy_Pillow 640786.4/1100000: 58% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
3:58.907 summon_doomguard Fluffy_Pillow 657337.7/1100000: 60% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:00.048 life_tap Fluffy_Pillow 673918.0/1100000: 61% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:01.186 chaos_bolt Fluffy_Pillow 1020454.8/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:03.460 conflagrate Fluffy_Pillow 1053500.2/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:04.583 chaos_bolt Fluffy_Pillow 1070060.8/1100000: 97% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:05.929 conflagrate Fluffy_Pillow 1089909.9/1100000: 99% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:07.050 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:08.396 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:09.504 soul_harvest Fluffy_Pillow 1028578.3/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:09.504 incinerate Fluffy_Pillow 1028578.3/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:10.830 chaos_bolt Fluffy_Pillow 982418.4/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:12.158 conflagrate Fluffy_Pillow 1002288.3/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:13.256 chaos_bolt Fluffy_Pillow 1018812.6/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:14.116 incinerate Fluffy_Pillow 1031866.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:14.965 incinerate Fluffy_Pillow 978936.0/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
4:15.803 chaos_bolt Fluffy_Pillow 925642.2/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:16.703 incinerate Fluffy_Pillow 938720.5/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:17.603 incinerate Fluffy_Pillow 885798.8/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:18.502 immolate Fluffy_Pillow 832862.5/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:19.256 chaos_bolt Fluffy_Pillow 777819.3/1100000: 71% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:20.155 chaos_bolt Fluffy_Pillow 790883.0/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:21.055 life_tap Fluffy_Pillow 803961.3/1100000: 73% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:21.810 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:22.710 incinerate Fluffy_Pillow 1034072.7/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:23.608 incinerate Fluffy_Pillow 981121.9/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:24.509 incinerate Fluffy_Pillow 928216.0/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:25.397 incinerate Fluffy_Pillow 875311.1/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
4:26.984 incinerate Fluffy_Pillow 832714.2/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
4:28.570 havoc enemy2 790226.7/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
4:29.873 immolate Fluffy_Pillow 721722.7/1100000: 66% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
4:31.177 conflagrate Fluffy_Pillow 675351.3/1100000: 61% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
4:32.461 dimensional_rift Fluffy_Pillow 694839.5/1100000: 63% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
4:33.728 chaos_bolt Fluffy_Pillow 714342.7/1100000: 65% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:35.874 conflagrate Fluffy_Pillow 747376.6/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:36.976 conflagrate Fluffy_Pillow 763932.4/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:38.116 conflagrate Fluffy_Pillow 780498.2/1100000: 71% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:38.871 service_imp Fluffy_Pillow 791469.4/1100000: 72% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:39.627 chaos_bolt Fluffy_Pillow 802455.2/1100000: 73% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:40.525 life_tap Fluffy_Pillow 815504.4/1100000: 74% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:41.280 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:42.180 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:43.079 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:43.965 incinerate Fluffy_Pillow 1034059.8/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:44.840 conflagrate Fluffy_Pillow 981151.9/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:45.595 chaos_bolt Fluffy_Pillow 992448.5/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:46.469 incinerate Fluffy_Pillow 1005525.6/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:47.341 chaos_bolt Fluffy_Pillow 952572.7/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:48.216 incinerate Fluffy_Pillow 965666.7/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:49.079 havoc enemy2 912866.8/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:49.831 incinerate Fluffy_Pillow 836480.2/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(5)
4:51.329 conflagrate Fluffy_Pillow 793861.8/1100000: 72% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(5)
4:52.579 immolate Fluffy_Pillow 813372.5/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5)
4:53.829 chaos_bolt Fluffy_Pillow 766883.2/1100000: 70% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5)
4:56.325 incinerate Fluffy_Pillow 804165.1/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
4:57.935 conflagrate Fluffy_Pillow 761560.7/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:59.075 chaos_bolt Fluffy_Pillow 778126.6/1100000: 71% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 53188 53188 34655
Intellect 50485 48779 39133 (1221)
Spirit 1 1 0
Health 3191280 3191280 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50485 48779 0
Crit 13.94% 13.94% 3577
Haste 32.10% 31.10% 11664
Damage / Heal Versatility 5.59% 5.59% 2656
ManaReg per Second 14531 14421 0
Mastery 66.63% 66.63% 5684
Armor 1988 1988 1988
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Lessons of Space-Time
ilevel: 940, stats: { 269 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Mastery }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Azj'Aqir
ilevel: 900, stats: { 156 Armor, +1831 Sta, +1221 StrAgiInt, +584 Vers, +345 Haste }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Lessons_of_Space-Time"
level=110
race=troll
role=spell
position=back
talents=2303021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=lessons_of_spacetime,id=144369,ilevel=940
back=cloak_of_azjaqir,id=138373,bonus_id=3445,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.93
# gear_stamina=34655
# gear_intellect=39133
# gear_crit_rating=3577
# gear_haste_rating=11664
# gear_mastery_rating=5684
# gear_versatility_rating=2656
# gear_armor=1988
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Magistrike's_Restraints : 972119 dps, 562225 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
972119.2 972119.2 628.9 / 0.065% 124161.5 / 12.8% 31.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
25376.4 25376.4 Mana 0.00% 51.0 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Magistrike's_Restraints 972119
Chaos Bolt 298299 30.7% 57.7 5.05sec 1554646 1030649 Direct 111.0 0 808327 808327 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.71 111.00 0.00 0.00 1.5084 0.0000 89725249.32 89725249.32 0.00 1030649.45 1030649.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 111.00 100.00% 808327.48 522764 1176660 808627.44 757330 859958 89725249 89725249 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 108989 11.2% 48.3 6.22sec 677911 652535 Direct 96.6 199499 452345 339108 55.2%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.30 96.57 0.00 0.00 1.0389 0.0000 32746154.43 32746154.43 0.00 652534.81 652534.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.25 44.79% 199498.86 129994 292613 199575.28 177674 219556 8628476 8628476 0.00
crit 53.32 55.21% 452344.97 260012 676969 452414.91 409688 496319 24117679 24117679 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 13712 1.4% 32.5 5.07sec 124611 0 Direct 32.5 107668 215428 124609 15.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.51 32.51 0.00 0.00 0.0000 0.0000 4051021.25 4051021.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.40 84.28% 107668.39 86750 114510 107665.93 102759 112601 2949898 2949898 0.00
crit 5.11 15.72% 215427.96 173500 229020 214219.90 0 229020 1101123 1101123 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 246559 25.4% 19.9 15.37sec 3732223 3539646 Direct 38.6 136641 273342 202067 47.9%  
Periodic 295.9 151806 303406 224042 47.6% 196.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.85 38.63 295.88 295.88 1.0544 2.0012 74095402.60 74095402.60 0.00 120865.33 3539645.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.14 52.14% 136641.29 90189 203008 136604.25 116484 156097 2751949 2751949 0.00
crit 18.49 47.86% 273341.84 180383 406019 273271.73 230409 317332 5053075 5053075 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 154.9 52.35% 151806.01 57 419472 151990.43 132432 172900 23514282 23514282 0.00
crit 141.0 47.65% 303406.22 190 838945 303799.25 265738 355392 42776097 42776097 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 126428 13.0% 75.9 3.78sec 502097 412811 Direct 146.3 225056 450290 260273 15.6%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.86 146.33 0.00 0.00 1.2163 0.0000 38086723.93 38086723.93 0.00 412810.52 412810.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 123.46 84.37% 225056.25 145790 328166 225002.98 210432 238186 27784461 27784461 0.00
crit 22.88 15.63% 450289.52 291968 656320 450190.59 383363 517861 10302263 10302263 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9576 1.0% 19.8 15.07sec 145054 0 Direct 19.8 125471 250769 145054 15.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.84 19.84 0.00 0.00 0.0000 0.0000 2878246.93 2878246.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.74 84.37% 125471.26 110344 145654 125478.74 118619 136984 2100545 2100545 0.00
crit 3.10 15.63% 250768.95 220687 291307 239751.20 0 291307 777702 777702 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 41652 / 41652
Firebolt 41652 4.3% 108.3 2.78sec 115626 92253 Direct 107.5 100703 201398 116520 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.31 107.48 0.00 0.00 1.2534 0.0000 12523570.21 12523570.21 0.00 92252.62 92252.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.60 84.29% 100702.94 65104 117187 100708.19 98459 102896 9123391 9123391 0.00
crit 16.88 15.71% 201398.41 130208 234374 201409.14 180844 221354 3400179 3400179 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 120214 / 38315
Firebolt 120214 3.9% 48.8 5.56sec 235208 199124 Direct 48.6 204332 408705 236502 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.85 48.58 0.00 0.00 1.1812 0.0000 11489057.16 11489057.16 0.00 199124.01 199124.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.93 84.26% 204331.84 130208 234374 204479.57 197792 211588 8363778 8363778 0.00
crit 7.65 15.74% 408705.39 260416 468749 408929.22 0 468749 3125279 3125279 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 105563 / 8934
Immolation 81277 0.7% 1.0 0.00sec 2032009 0 Periodic 44.0 39940 79886 46167 15.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.01 44.01 0.0000 1.1066 2032009.29 2032009.29 0.00 83443.22 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.2 84.41% 39940.38 34482 41379 39940.43 39154 40948 1483903 1483903 0.00
crit 6.9 15.59% 79885.98 68965 82758 79857.99 0 82758 548107 548107 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24286 0.2% 22.0 1.11sec 27590 24933 Direct 22.0 23886 47751 27591 15.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1066 0.0000 607177.34 892608.20 31.98 24933.37 24933.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.59 84.48% 23886.37 20621 24745 23886.57 23026 24745 444085 652848 31.98
crit 3.42 15.52% 47751.24 41241 49489 46540.06 0 49489 163092 239761 31.16
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 92515 / 7823
Doom Bolt 92515 0.8% 10.6 2.26sec 217778 96353 Direct 10.6 188279 376583 217785 15.7%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.62 10.62 0.00 0.00 2.2603 0.0000 2312963.92 2312963.92 0.00 96353.42 96353.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.96 84.33% 188279.09 182068 218482 188320.52 182068 218482 1686222 1686222 0.00
crit 1.66 15.67% 376582.77 364136 436964 314218.31 0 436964 626742 626742 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 105680 / 8942
Immolation 81386 0.7% 1.0 0.00sec 2034722 0 Periodic 44.0 39942 79869 46229 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.01 44.01 0.0000 1.1066 2034721.95 2034721.95 0.00 83554.61 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.1 84.25% 39941.92 34482 41379 39941.82 39154 40961 1481190 1481190 0.00
crit 6.9 15.75% 79869.39 68965 82758 79841.41 0 82758 553532 553532 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24294 0.2% 22.0 1.11sec 27599 24941 Direct 22.0 23884 47773 27599 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1066 0.0000 607374.90 892898.64 31.98 24941.48 24941.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.58 84.45% 23884.36 20621 24745 23884.47 23158 24745 443888 652557 31.98
crit 3.42 15.55% 47773.14 41241 49489 46636.65 0 49489 163487 240341 31.21
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 105684 / 8943
Immolation 81345 0.7% 1.0 0.00sec 2033705 0 Periodic 44.0 39940 79893 46206 15.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.01 44.01 0.0000 1.1066 2033705.31 2033705.31 0.00 83512.87 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.1 84.32% 39939.72 34482 41379 39939.51 39154 40961 1482207 1482207 0.00
crit 6.9 15.68% 79893.04 68965 82758 79856.51 0 82758 551499 551499 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24339 0.2% 22.0 1.11sec 27650 24987 Direct 22.0 23883 47792 27651 15.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1066 0.0000 608495.12 894545.47 31.98 24987.48 24987.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.54 84.24% 23882.57 20621 24745 23882.50 23158 24745 442768 650910 31.98
crit 3.47 15.76% 47792.24 41241 49489 46675.71 0 49489 165727 243635 31.23
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 105608 / 8937
Immolation 81294 0.7% 1.0 0.00sec 2032430 0 Periodic 44.0 39936 79931 46176 15.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.01 44.01 0.0000 1.1066 2032430.02 2032430.02 0.00 83460.50 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.1 84.40% 39936.23 34482 41379 39936.66 39224 40934 1483482 1483482 0.00
crit 6.9 15.60% 79930.87 68965 82758 79870.72 0 82758 548948 548948 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24314 0.2% 22.0 1.11sec 27622 24962 Direct 22.0 23885 47764 27622 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 0.00 0.00 1.1066 0.0000 607877.68 893637.77 31.98 24962.13 24962.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.56 84.35% 23885.17 20621 24745 23885.30 23272 24528 443385 651818 31.98
crit 3.44 15.65% 47764.37 41241 49489 46590.48 0 49489 164493 241820 31.19
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 112365 / 19029
Shadow Bolt 112365 1.9% 4.4 59.21sec 1306283 0 Periodic 46.1 106859 213726 123529 15.6% 19.7%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 0.00 46.34 46.07 0.0000 1.2785 5691341.08 5691341.08 0.00 96070.98 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.9 84.40% 106858.91 68 127321 106694.85 0 127321 4155464 4155464 0.00
crit 7.2 15.60% 213726.22 181 254642 210965.31 0 254642 1535877 1535877 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 136052 / 9257
Chaos Bolt 136052 1.0% 4.3 60.04sec 644640 309689 Direct 4.3 0 649050 649050 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.28 0.00 0.00 2.0817 0.0000 2778525.79 2778525.79 0.00 309688.56 309688.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.28 100.00% 649050.39 613669 736403 649509.67 0 736403 2778526 2778526 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 227856 / 17069
Chaos Barrage 227856 1.8% 4.4 60.22sec 1169135 0 Periodic 143.9 30709 61407 35509 15.6% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.37 0.00 144.62 143.90 0.0000 0.1641 5109688.28 5109688.28 0.00 215371.48 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.4 84.37% 30709.30 151 35014 30675.33 0 35014 3728129 3728129 0.00
crit 22.5 15.63% 61407.21 307 70028 61327.33 0 70028 1381560 1381560 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Magistrike's_Restraints
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Magistrike's_Restraints
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.65sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.0 23.64sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.96 0.00 0.00 0.00 1.0048 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Magistrike's_Restraints
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Magistrike's_Restraints
  • harmful:false
  • if_expr:
 
Havoc 15.1 20.69sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.05 0.00 0.00 0.00 1.0648 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.1 20.64sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.12 0.00 0.00 0.00 1.0024 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.87sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 0.9743 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.19sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.88 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0835 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7577 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.53% 78.53% 1.4(1.4) 19.3

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.82%
  • accelerando_2:24.65%
  • accelerando_3:14.63%
  • accelerando_4:6.51%
  • accelerando_5:2.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.6sec 180.6sec 6.85% 7.43% 0.0(0.0) 2.0

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.1 0.0 12.4sec 12.4sec 49.15% 46.91% 0.0(0.0) 0.9

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.15%

Trigger Attempt Success

  • trigger_pct:49.89%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.8sec 69.8sec 8.70% 8.70% 0.0(0.0) 3.2

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.70%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.3 32.4 11.7sec 5.1sec 59.29% 67.25% 32.4(32.4) 25.7

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 9.0 6.1 34.0sec 20.6sec 97.10% 95.30% 52.1(52.1) 8.1

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:97.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.89% 97.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.1sec 69.2sec 13.53% 13.53% 0.0(0.0) 3.3

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.53%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 127.9sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 121.2sec 121.2sec 17.74% 17.74% 0.0(0.0) 2.7

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.3 59.8sec
chaos_tear 4.3 59.8sec
chaos_portal 4.3 59.8sec
dimension_ripper 3.8 55.4sec

Resources

Resource Usage Type Count Total Average RPE APR
Magistrike's_Restraints
chaos_bolt Soul Shard 58.7 117.4 2.0 2.0 764088.8
havoc Mana 15.1 1324433.9 88000.0 87999.9 0.0
immolate Mana 19.9 1310281.1 66000.0 65999.5 56.5
incinerate Mana 75.9 5006472.5 66000.0 66000.2 7.6
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.3 4332.4 40.0 40.0 2890.7
pet - service_imp
firebolt Energy 48.8 1953.9 40.0 40.0 5880.0
pet - doomguard
doom_bolt Energy 10.6 371.7 35.0 35.0 6222.2
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.12 3619947.19 (48.18%) 239481.57 1368255.35 27.43%
immolate Soul Shard 65.64 64.88 (53.22%) 0.99 0.76 1.16%
conflagrate Soul Shard 48.30 48.22 (39.56%) 1.00 0.08 0.17%
mp5_regen Mana 479.16 3893812.78 (51.82%) 8126.36 715568.94 15.52%
soulsnatcher Soul Shard 8.80 8.80 (7.22%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1867.08 4166.32 (100.00%) 2.23 22.81 0.54%
pet - service_imp
energy_regen Energy 421.58 1332.60 (100.00%) 3.16 63.82 4.57%
pet - doomguard
energy_regen Energy 10.62 336.63 (100.00%) 31.70 45.21 11.84%
Resource RPS-Gain RPS-Loss
Health 0.00 15946.31
Mana 24953.09 25376.36
Soul Shard 0.40 0.41
Combat End Resource Mean Min Max
Mana 970613.30 422467.61 1100000.00
Soul Shard 1.84 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 14.4%

Statistics & Data Analysis

Fight Length
Sample Data Magistrike's_Restraints Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Magistrike's_Restraints Damage Per Second
Count 9999
Mean 972119.20
Minimum 864180.47
Maximum 1117260.69
Spread ( max - min ) 253080.22
Range [ ( max - min ) / 2 * 100% ] 13.02%
Standard Deviation 32083.2254
5th Percentile 922046.49
95th Percentile 1026882.41
( 95th Percentile - 5th Percentile ) 104835.93
Mean Distribution
Standard Deviation 320.8483
95.00% Confidence Intervall ( 971490.35 - 972748.05 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4185
0.1 Scale Factor Error with Delta=300 8786982
0.05 Scale Factor Error with Delta=300 35147927
0.01 Scale Factor Error with Delta=300 878698155
Priority Target DPS
Sample Data Magistrike's_Restraints Priority Target Damage Per Second
Count 9999
Mean 562225.02
Minimum 496857.98
Maximum 647853.03
Spread ( max - min ) 150995.04
Range [ ( max - min ) / 2 * 100% ] 13.43%
Standard Deviation 19233.0297
5th Percentile 532211.66
95th Percentile 595077.93
( 95th Percentile - 5th Percentile ) 62866.27
Mean Distribution
Standard Deviation 192.3399
95.00% Confidence Intervall ( 561848.04 - 562601.99 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4496
0.1 Scale Factor Error with Delta=300 3157760
0.05 Scale Factor Error with Delta=300 12631039
0.01 Scale Factor Error with Delta=300 315775968
DPS(e)
Sample Data Magistrike's_Restraints Damage Per Second (Effective)
Count 9999
Mean 972119.20
Minimum 864180.47
Maximum 1117260.69
Spread ( max - min ) 253080.22
Range [ ( max - min ) / 2 * 100% ] 13.02%
Damage
Sample Data Magistrike's_Restraints Damage
Count 9999
Mean 241582798.46
Minimum 172683247.26
Maximum 317758439.95
Spread ( max - min ) 145075192.69
Range [ ( max - min ) / 2 * 100% ] 30.03%
DTPS
Sample Data Magistrike's_Restraints Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Magistrike's_Restraints Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Magistrike's_Restraints Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Magistrike's_Restraints Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Magistrike's_Restraints Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Magistrike's_Restraints Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Magistrike's_RestraintsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Magistrike's_Restraints Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 15.05 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.18 immolate,if=remains<=tick_time
F 0.53 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.18 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.83 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.48 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
L 14.12 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
M 3.67 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.88 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 11.96 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 58.03 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 76.17 incinerate
0.00 life_tap

Sample Sequence

01269ABCDEGHJKMKNPQKQRRSKRSQSKRLCSQSSESSSSRGJRKKRRKLCRSKQRSSSSSESQLRCGJRKRKRRSKRSRSSSKLSCRESRSQSSMGJKKLRCKRRRRKRSSRELSSSCSPISRGJKRKQRKLRRSCKRSSSESSSSLSRGCJKRKRFKRSQLKQHRSCSSEQSSMSRSQRGJKKLRCRKRRKRSSSSELRQSCSSGJROKRKRKLRRKCPRSSSESSSSSRLRGJKRCKQRRSJRSQJMLSRECFJRJRRR

Sample Sequence Table

time name target resources buffs
Pre flask Magistrike's_Restraints 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Magistrike's_Restraints 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Magistrike's_Restraints 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.113 dimensional_rift Fluffy_Pillow 1032855.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.997 immolate Fluffy_Pillow 1049419.7/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.882 immolate Fluffy_Pillow 1000004.2/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.754 berserking Fluffy_Pillow 950588.1/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.754 conflagrate Fluffy_Pillow 950588.1/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:04.512 conflagrate Fluffy_Pillow 967166.3/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:05.272 service_imp Fluffy_Pillow 983788.2/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:06.030 conflagrate Fluffy_Pillow 1000366.4/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:06.789 summon_infernal Fluffy_Pillow 1016966.5/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:07.547 soul_harvest Fluffy_Pillow 1033544.7/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:07.547 dimensional_rift Fluffy_Pillow 1033544.7/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:08.305 conflagrate Fluffy_Pillow 1050122.9/1100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:09.064 dimensional_rift Fluffy_Pillow 1066723.0/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:09.823 chaos_bolt Fluffy_Pillow 1083323.0/1100000: 98% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:11.336 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:12.232 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:13.152 conflagrate Fluffy_Pillow 1034043.1/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:13.946 chaos_bolt Fluffy_Pillow 1050613.1/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:15.006 incinerate Fluffy_Pillow 1070475.3/1100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:16.066 dimensional_rift Fluffy_Pillow 1024569.1/1100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:16.937 incinerate Fluffy_Pillow 1041133.9/1100000: 95% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:17.982 conflagrate Fluffy_Pillow 995008.0/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:18.853 chaos_bolt Fluffy_Pillow 1011572.9/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:19.898 life_tap Fluffy_Pillow 1031446.9/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:20.771 havoc enemy2 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:21.643 incinerate Fluffy_Pillow 1028583.9/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:22.690 dimensional_rift Fluffy_Pillow 982496.0/1100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:23.560 incinerate Fluffy_Pillow 999041.9/1100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:24.607 incinerate Fluffy_Pillow 952703.0/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
0:25.667 immolate Fluffy_Pillow 906565.2/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
0:26.550 incinerate Fluffy_Pillow 857110.8/1100000: 78% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando, potion_of_deadly_grace
0:27.611 incinerate Fluffy_Pillow 810991.8/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando, potion_of_deadly_grace
0:28.672 incinerate Fluffy_Pillow 764872.8/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando
0:29.731 incinerate Fluffy_Pillow 718716.3/1100000: 65% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando
0:30.791 chaos_bolt Fluffy_Pillow 672578.5/1100000: 61% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando
0:32.555 immolate Fluffy_Pillow 705632.3/1100000: 64% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:33.438 conflagrate Fluffy_Pillow 656178.7/1100000: 60% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:34.310 chaos_bolt Fluffy_Pillow 672762.6/1100000: 61% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:35.356 conflagrate Fluffy_Pillow 692655.7/1100000: 63% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:36.228 conflagrate Fluffy_Pillow 709239.6/1100000: 64% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:37.112 chaos_bolt Fluffy_Pillow 725765.5/1100000: 66% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:38.191 chaos_bolt Fluffy_Pillow 745681.7/1100000: 68% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:39.267 conflagrate Fluffy_Pillow 765542.6/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:40.165 life_tap Fluffy_Pillow 782117.9/1100000: 71% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, embrace_chaos
0:41.081 havoc enemy2 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:42.248 chaos_bolt Fluffy_Pillow 1028569.7/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:43.646 incinerate Fluffy_Pillow 1048437.5/1100000: 95% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:45.025 conflagrate Fluffy_Pillow 1002315.4/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:46.199 dimensional_rift Fluffy_Pillow 1019490.3/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:47.330 chaos_bolt Fluffy_Pillow 1036036.2/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:48.688 incinerate Fluffy_Pillow 1056028.5/1100000: 96% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:50.025 incinerate Fluffy_Pillow 1009875.9/1100000: 92% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:51.362 incinerate Fluffy_Pillow 963724.1/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:52.680 incinerate Fluffy_Pillow 917573.6/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:53.998 incinerate Fluffy_Pillow 871423.1/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
0:55.317 immolate Fluffy_Pillow 825287.7/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
0:56.469 incinerate Fluffy_Pillow 775854.6/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:57.867 dimensional_rift Fluffy_Pillow 729704.2/1100000: 66% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:59.032 life_tap Fluffy_Pillow 746245.4/1100000: 68% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:00.197 chaos_bolt Fluffy_Pillow 1092786.7/1100000: 99% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:02.525 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:03.673 immolate Fluffy_Pillow 1028547.1/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:04.820 conflagrate Fluffy_Pillow 979305.7/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:05.950 chaos_bolt Fluffy_Pillow 995836.9/1100000: 91% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:07.308 conflagrate Fluffy_Pillow 1015703.6/1100000: 92% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:08.055 chaos_bolt Fluffy_Pillow 1026741.8/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:08.937 conflagrate Fluffy_Pillow 1039836.2/1100000: 95% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:09.691 chaos_bolt Fluffy_Pillow 1051191.6/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:10.560 chaos_bolt Fluffy_Pillow 1064279.1/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:11.428 incinerate Fluffy_Pillow 1077351.4/1100000: 98% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:12.298 conflagrate Fluffy_Pillow 1024453.9/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:13.054 chaos_bolt Fluffy_Pillow 1035839.5/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
1:13.920 incinerate Fluffy_Pillow 1048505.1/1100000: 95% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
1:14.841 chaos_bolt Fluffy_Pillow 995742.1/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:15.747 incinerate Fluffy_Pillow 1008801.1/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:16.654 incinerate Fluffy_Pillow 955874.4/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:17.561 incinerate Fluffy_Pillow 903041.1/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
1:18.453 conflagrate Fluffy_Pillow 850090.5/1100000: 77% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:19.793 life_tap Fluffy_Pillow 869693.9/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
1:21.125 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
1:22.725 havoc enemy2 1034087.8/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
1:24.059 chaos_bolt Fluffy_Pillow 965603.4/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
1:26.723 immolate Fluffy_Pillow 1004332.3/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:27.870 incinerate Fluffy_Pillow 954865.6/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:29.227 chaos_bolt Fluffy_Pillow 908717.7/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:30.586 incinerate Fluffy_Pillow 928599.0/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:31.945 dimensional_rift Fluffy_Pillow 882480.4/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:33.072 incinerate Fluffy_Pillow 899042.0/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:34.410 incinerate Fluffy_Pillow 852905.4/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:35.730 service_imp Fluffy_Pillow 806785.0/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
1:36.830 immolate Fluffy_Pillow 823351.3/1100000: 75% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
1:37.928 conflagrate Fluffy_Pillow 773888.2/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(5)
1:39.044 conflagrate Fluffy_Pillow 790460.8/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
1:40.210 conflagrate Fluffy_Pillow 807016.3/1100000: 73% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
1:41.376 life_tap Fluffy_Pillow 823571.7/1100000: 75% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
1:42.541 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:44.870 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:46.020 conflagrate Fluffy_Pillow 1028575.9/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:47.168 chaos_bolt Fluffy_Pillow 1045122.9/1100000: 95% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:48.544 chaos_bolt Fluffy_Pillow 1064956.4/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:49.922 chaos_bolt Fluffy_Pillow 1084818.6/1100000: 99% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:51.300 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:52.677 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:53.816 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:55.174 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:56.512 incinerate Fluffy_Pillow 1034072.1/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:57.888 chaos_bolt Fluffy_Pillow 987905.5/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:59.264 immolate Fluffy_Pillow 1007738.9/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:00.414 life_tap Fluffy_Pillow 958314.8/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:01.557 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:02.913 incinerate Fluffy_Pillow 1034043.9/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:04.271 incinerate Fluffy_Pillow 987910.6/1100000: 90% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:05.627 havoc enemy2 941748.1/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:06.759 incinerate Fluffy_Pillow 870308.6/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:08.116 soul_harvest Fluffy_Pillow 824166.3/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:08.116 potion Fluffy_Pillow 824166.3/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:08.116 incinerate Fluffy_Pillow 824166.3/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:09.454 chaos_bolt Fluffy_Pillow 777417.7/1100000: 71% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:11.748 immolate Fluffy_Pillow 810483.0/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:12.897 conflagrate Fluffy_Pillow 761044.4/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:14.046 conflagrate Fluffy_Pillow 777605.9/1100000: 71% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:15.178 chaos_bolt Fluffy_Pillow 794166.4/1100000: 72% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:16.536 conflagrate Fluffy_Pillow 814034.2/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:17.653 dimensional_rift Fluffy_Pillow 830615.8/1100000: 76% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:18.769 chaos_bolt Fluffy_Pillow 847182.5/1100000: 77% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:20.107 conflagrate Fluffy_Pillow 867044.7/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:21.224 life_tap Fluffy_Pillow 883626.3/1100000: 80% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:22.379 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:23.776 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:25.174 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:26.551 havoc enemy2 1034057.7/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:27.700 conflagrate Fluffy_Pillow 962619.1/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:28.847 chaos_bolt Fluffy_Pillow 979151.8/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:30.225 incinerate Fluffy_Pillow 999014.0/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:31.602 incinerate Fluffy_Pillow 952861.8/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:32.979 incinerate Fluffy_Pillow 906710.5/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:34.338 immolate Fluffy_Pillow 860591.9/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:35.468 incinerate Fluffy_Pillow 811123.1/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:36.827 incinerate Fluffy_Pillow 765004.5/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2), potion_of_deadly_grace
2:38.186 incinerate Fluffy_Pillow 718448.1/1100000: 65% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
2:39.586 incinerate Fluffy_Pillow 672549.7/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:40.964 life_tap Fluffy_Pillow 626439.5/1100000: 57% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:42.095 incinerate Fluffy_Pillow 972985.4/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:43.453 chaos_bolt Fluffy_Pillow 926922.7/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
2:45.680 immolate Fluffy_Pillow 959981.9/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:46.796 havoc enemy2 910548.6/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:47.912 conflagrate Fluffy_Pillow 839115.3/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:49.028 conflagrate Fluffy_Pillow 855682.1/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:50.143 chaos_bolt Fluffy_Pillow 872233.9/1100000: 79% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:52.368 conflagrate Fluffy_Pillow 904086.7/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:53.534 chaos_bolt Fluffy_Pillow 920642.1/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:54.932 immolate enemy2 940629.4/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:56.081 conflagrate Fluffy_Pillow 891190.9/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:57.221 chaos_bolt Fluffy_Pillow 907743.2/1100000: 83% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:58.578 incinerate Fluffy_Pillow 927595.3/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:59.934 dimensional_rift Fluffy_Pillow 881432.8/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:01.066 life_tap Fluffy_Pillow 897993.3/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:02.198 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:03.331 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:04.462 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:04.462 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:06.428 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:07.228 havoc enemy2 1034066.3/1100000: 94% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:07.981 incinerate Fluffy_Pillow 958547.9/1100000: 87% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:08.771 incinerate Fluffy_Pillow 905642.9/1100000: 82% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:09.560 immolate Fluffy_Pillow 852721.3/1100000: 78% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:10.314 dimensional_rift Fluffy_Pillow 799219.5/1100000: 73% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:11.067 incinerate Fluffy_Pillow 811714.0/1100000: 74% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:11.844 incinerate Fluffy_Pillow 758787.1/1100000: 69% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:12.611 service_imp Fluffy_Pillow 705880.9/1100000: 64% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:13.365 incinerate Fluffy_Pillow 718752.8/1100000: 65% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:14.130 chaos_bolt Fluffy_Pillow 665812.4/1100000: 61% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
3:15.407 incinerate Fluffy_Pillow 685508.4/1100000: 62% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:16.289 dimensional_rift Fluffy_Pillow 632601.4/1100000: 58% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:17.046 chaos_bolt Fluffy_Pillow 643838.9/1100000: 59% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
3:17.927 immolate Fluffy_Pillow 656917.1/1100000: 60% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
3:19.249 conflagrate Fluffy_Pillow 610386.9/1100000: 55% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:20.600 conflagrate Fluffy_Pillow 629860.0/1100000: 57% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
3:21.955 conflagrate Fluffy_Pillow 649390.7/1100000: 59% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:23.306 life_tap Fluffy_Pillow 668863.8/1100000: 61% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:24.659 chaos_bolt Fluffy_Pillow 1018365.6/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:27.361 havoc enemy2 1057881.3/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:28.460 chaos_bolt Fluffy_Pillow 986432.6/1100000: 90% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:29.779 conflagrate Fluffy_Pillow 1006297.1/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:30.869 chaos_bolt Fluffy_Pillow 1022840.1/1100000: 93% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
3:32.169 chaos_bolt Fluffy_Pillow 1041693.5/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:33.567 conflagrate Fluffy_Pillow 1061543.0/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:34.734 chaos_bolt Fluffy_Pillow 1078112.7/1100000: 98% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:36.131 incinerate Fluffy_Pillow 1098236.1/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:37.508 incinerate Fluffy_Pillow 1034057.7/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:38.884 incinerate Fluffy_Pillow 987891.1/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:40.261 incinerate Fluffy_Pillow 941839.6/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:41.619 immolate Fluffy_Pillow 895707.4/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:42.735 life_tap Fluffy_Pillow 846274.1/1100000: 77% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:43.850 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:46.077 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:47.248 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:48.645 havoc enemy2 1034042.6/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:49.811 incinerate Fluffy_Pillow 962598.1/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:51.211 incinerate Fluffy_Pillow 916477.3/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:52.588 immolate Fluffy_Pillow 870325.9/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:53.720 conflagrate Fluffy_Pillow 820886.4/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:54.851 chaos_bolt Fluffy_Pillow 837432.3/1100000: 76% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:57.111 summon_doomguard Fluffy_Pillow 870494.8/1100000: 79% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:58.241 conflagrate Fluffy_Pillow 887026.0/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:59.356 chaos_bolt Fluffy_Pillow 903577.9/1100000: 82% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:00.694 conflagrate Fluffy_Pillow 923440.1/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:01.809 chaos_bolt Fluffy_Pillow 939992.0/1100000: 85% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:03.144 conflagrate Fluffy_Pillow 959809.7/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:04.304 life_tap Fluffy_Pillow 976319.4/1100000: 89% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:05.470 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:06.869 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:08.268 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:09.433 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:10.573 soul_harvest Fluffy_Pillow 1028568.2/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:10.573 chaos_bolt Fluffy_Pillow 1028568.2/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:11.930 incinerate Fluffy_Pillow 1048421.2/1100000: 95% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:13.268 incinerate Fluffy_Pillow 1002284.5/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:14.587 incinerate Fluffy_Pillow 956149.1/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:15.905 immolate Fluffy_Pillow 909998.6/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:17.006 incinerate Fluffy_Pillow 860580.0/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4)
4:18.325 incinerate Fluffy_Pillow 814445.6/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5)
4:19.625 incinerate Fluffy_Pillow 768303.9/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5)
4:20.926 incinerate Fluffy_Pillow 722177.5/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5)
4:22.227 incinerate Fluffy_Pillow 675195.9/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact
4:23.147 chaos_bolt Fluffy_Pillow 622258.5/1100000: 57% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact
4:24.678 life_tap Fluffy_Pillow 643996.4/1100000: 59% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:25.442 chaos_bolt Fluffy_Pillow 984871.0/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:26.349 immolate Fluffy_Pillow 997944.3/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:27.105 conflagrate Fluffy_Pillow 942841.2/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:27.861 conflagrate Fluffy_Pillow 953738.0/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:28.619 chaos_bolt Fluffy_Pillow 964663.7/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:29.526 havoc enemy2 977737.0/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:30.282 conflagrate Fluffy_Pillow 900633.9/1100000: 82% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:31.037 dimensional_rift Fluffy_Pillow 911516.3/1100000: 83% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:31.872 chaos_bolt Fluffy_Pillow 923551.8/1100000: 84% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:32.781 chaos_bolt Fluffy_Pillow 936654.0/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:33.688 incinerate Fluffy_Pillow 949727.3/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
4:35.311 conflagrate Fluffy_Pillow 907122.0/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
4:36.644 chaos_bolt Fluffy_Pillow 926623.0/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:38.243 incinerate Fluffy_Pillow 949616.4/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
4:39.889 dimensional_rift Fluffy_Pillow 906987.2/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
4:41.262 conflagrate Fluffy_Pillow 926481.7/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
4:42.636 service_imp Fluffy_Pillow 945990.5/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
4:43.802 life_tap Fluffy_Pillow 962545.9/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
4:44.950 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
4:46.307 chaos_bolt Fluffy_Pillow 1034059.4/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
4:48.535 immolate Fluffy_Pillow 1067133.4/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:49.651 havoc enemy2 1017700.1/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:50.766 immolate enemy2 946252.0/1100000: 86% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:51.881 conflagrate Fluffy_Pillow 896803.8/1100000: 82% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:52.998 chaos_bolt Fluffy_Pillow 913385.4/1100000: 83% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:55.224 conflagrate Fluffy_Pillow 946672.1/1100000: 86% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:56.344 chaos_bolt Fluffy_Pillow 963228.5/1100000: 88% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:57.742 chaos_bolt Fluffy_Pillow 983208.1/1100000: 89% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:59.120 chaos_bolt Fluffy_Pillow 1003172.3/1100000: 91% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52943 52943 34467
Intellect 50353 48647 39007 (1278)
Spirit 1 1 0
Health 3176580 3176580 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50353 48647 0
Crit 15.68% 15.68% 4271
Haste 29.08% 28.08% 10529
Damage / Heal Versatility 5.36% 5.36% 2544
ManaReg per Second 14199 14089 0
Mastery 70.53% 70.53% 6204
Armor 1975 1975 1975
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Magistrike Restraints
ilevel: 940, stats: { 157 Armor, +2658 Sta, +1772 Int, +694 Crit, +385 Mastery }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Magistrike's_Restraints"
level=110
race=troll
role=spell
position=back
talents=2303021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=magistrikes_restraints,id=132407,ilevel=940
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=907.27
# gear_stamina=34467
# gear_intellect=39007
# gear_crit_rating=4271
# gear_haste_rating=10529
# gear_mastery_rating=6204
# gear_versatility_rating=2544
# gear_armor=1975
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Norgannon's : 973391 dps, 562361 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
973391.2 973391.2 617.4 / 0.063% 122947.0 / 12.6% 30.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
26385.7 26385.7 Mana 0.00% 52.4 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Norgannon's 973391
Chaos Bolt 293345 30.2% 58.5 5.00sec 1508583 1030535 Direct 112.9 0 781590 781590 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.50 112.91 0.00 0.00 1.4639 0.0000 88246739.06 88246739.06 0.00 1030534.60 1030534.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 112.91 100.00% 781589.54 508287 1134648 781886.72 733279 831155 88246739 88246739 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 108924 11.2% 49.5 6.07sec 661840 652947 Direct 98.9 199738 442243 331058 54.1%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.46 98.88 0.00 0.00 1.0136 0.0000 32735505.11 32735505.11 0.00 652947.14 652947.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.34 45.85% 199738.20 130806 291996 199769.59 181750 220011 9055751 9055751 0.00
crit 53.55 54.15% 442242.86 261622 652794 442342.21 395542 486297 23679754 23679754 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 13753 1.4% 33.5 4.94sec 121297 0 Direct 33.5 108405 216934 121296 11.9%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.50 33.50 0.00 0.00 0.0000 0.0000 4063209.97 4063209.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.52 88.12% 108404.65 87244 115162 108404.50 103686 113029 3199961 3199961 0.00
crit 3.98 11.88% 216934.21 174488 230324 213792.20 0 230324 863249 863249 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 250216 25.7% 20.3 14.96sec 3702891 3602678 Direct 39.2 136426 272667 196128 43.8%  
Periodic 305.0 153856 307820 221310 43.8% 196.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.31 39.18 305.05 305.05 1.0278 1.9410 75195095.54 75195095.54 0.00 122673.77 3602678.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.01 56.18% 136426.33 90750 202583 136391.83 119096 156968 3002634 3002634 0.00
crit 17.17 43.82% 272666.99 181509 405160 272590.58 225723 331039 4681427 4681427 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.4 56.19% 153855.66 73 489546 154041.47 135385 175329 26371180 26371180 0.00
crit 133.6 43.81% 307819.96 182 1024538 308195.85 262763 363838 41139855 41139855 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 128849 13.3% 80.0 3.58sec 485121 409974 Direct 154.1 225199 450581 251805 11.8%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.98 154.08 0.00 0.00 1.1833 0.0000 38797936.29 38797936.29 0.00 409974.49 409974.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.89 88.20% 225198.86 146694 327475 225184.70 211699 237885 30602685 30602685 0.00
crit 18.19 11.80% 450581.30 293422 654950 450504.43 378611 535046 8195251 8195251 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9589 1.0% 20.4 14.60sec 141187 0 Direct 20.4 126306 252407 141187 11.8%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.43 20.43 0.00 0.00 0.0000 0.0000 2884271.62 2884271.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.02 88.20% 126306.14 111029 146559 126315.38 120424 136501 2275785 2275785 0.00
crit 2.41 11.80% 252406.65 222059 293117 230859.05 0 293117 608486 608486 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 41603 / 41603
Firebolt 41603 4.3% 111.3 2.70sec 112356 92395 Direct 110.5 101302 202595 113219 11.8%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.33 110.49 0.00 0.00 1.2160 0.0000 12509145.20 12509145.20 0.00 92395.47 92395.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.49 88.23% 101302.18 65509 117915 101305.80 99148 103335 9875619 9875619 0.00
crit 13.00 11.77% 202595.34 131017 235831 202609.17 163771 229280 2633526 2633526 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 118326 / 37647
Firebolt 118326 3.9% 49.2 5.51sec 229294 199862 Direct 49.0 206084 412083 230529 11.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.24 48.97 0.00 0.00 1.1473 0.0000 11289984.55 11289984.55 0.00 199861.65 199861.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.16 88.13% 206083.97 131017 235831 206240.16 199089 212710 8895139 8895139 0.00
crit 5.81 11.87% 412083.17 262034 471662 411024.31 0 471662 2394845 2394845 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 107051 / 9059
Immolation 82445 0.7% 1.0 0.00sec 2061219 0 Periodic 45.9 40139 80270 44899 11.9% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.95 45.91 0.0000 1.0746 2061219.27 2061219.27 0.00 83568.59 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.5 88.14% 40139.01 34697 41636 40139.32 39533 40906 1624056 1624056 0.00
crit 5.4 11.86% 80269.63 69393 83272 80036.80 0 83272 437163 437163 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24606 0.2% 23.0 1.08sec 26801 24941 Direct 23.0 24003 48007 26800 11.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.95 22.95 0.00 0.00 1.0746 0.0000 615167.90 904355.08 31.98 24940.92 24940.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.28 88.34% 24002.88 20749 24898 24003.04 23416 24898 486735 715546 31.98
crit 2.68 11.66% 48007.01 41497 49797 44978.93 0 49797 128433 188809 29.96
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 93250 / 7881
Doom Bolt 93250 0.8% 11.0 2.20sec 211745 96464 Direct 11.0 189447 378966 211753 11.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.01 11.01 0.00 0.00 2.1951 0.0000 2331335.14 2331335.14 0.00 96463.72 96463.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.71 88.23% 189446.51 183200 219840 189452.28 183200 219840 1840274 1840274 0.00
crit 1.30 11.77% 378965.93 366399 439679 284293.84 0 439679 491061 491061 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 106988 / 9053
Immolation 82357 0.7% 1.0 0.00sec 2059004 0 Periodic 45.9 40138 80283 44852 11.7% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.95 45.91 0.0000 1.0746 2059004.01 2059004.01 0.00 83478.78 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.5 88.26% 40138.14 34697 41636 40138.51 39323 41041 1626271 1626271 0.00
crit 5.4 11.74% 80282.64 69393 83272 79997.54 0 83272 432733 432733 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24631 0.2% 23.0 1.08sec 26829 24967 Direct 23.0 24002 48016 26828 11.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.95 22.95 0.00 0.00 1.0746 0.0000 615810.76 905300.14 31.98 24966.99 24966.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.25 88.23% 24002.30 20749 24898 24002.57 23515 24668 486092 714601 31.98
crit 2.70 11.77% 48015.65 41497 49797 45367.23 0 49797 129719 190699 30.20
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 107041 / 9058
Immolation 82402 0.7% 1.0 0.00sec 2060144 0 Periodic 45.9 40139 80275 44876 11.8% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.95 45.91 0.0000 1.0746 2060143.57 2060143.57 0.00 83524.98 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.5 88.20% 40138.65 34697 41636 40138.99 39501 40924 1625132 1625132 0.00
crit 5.4 11.80% 80275.02 69393 83272 80047.64 0 83272 435012 435012 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24638 0.2% 23.0 1.08sec 26836 24974 Direct 23.0 24004 47986 26836 11.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.95 22.95 0.00 0.00 1.0746 0.0000 615983.40 905553.95 31.98 24973.99 24973.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.24 88.19% 24004.26 20749 24898 24004.74 23416 24898 485919 714347 31.98
crit 2.71 11.81% 47986.32 41497 49797 45280.51 0 49797 130064 191207 30.16
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 107059 / 9060
Immolation 82400 0.7% 1.0 0.00sec 2060082 0 Periodic 45.9 40139 80264 44875 11.8% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.95 45.91 0.0000 1.0746 2060082.49 2060082.49 0.00 83522.50 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.5 88.20% 40139.39 34697 41636 40139.71 39554 40886 1625193 1625193 0.00
crit 5.4 11.80% 80263.93 69393 83272 80037.74 0 83272 434890 434890 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24659 0.2% 23.0 1.08sec 26858 24995 Direct 23.0 24002 48014 26858 11.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.95 22.95 0.00 0.00 1.0746 0.0000 616490.55 906299.51 31.98 24994.55 24994.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.22 88.11% 24002.37 20749 24898 24002.66 23302 24680 485412 713602 31.98
crit 2.73 11.89% 48014.49 41497 49797 45509.68 0 49797 131078 192698 30.30
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 112647 / 19297
Shadow Bolt 112647 2.0% 4.4 58.76sec 1308588 0 Periodic 47.2 109526 218758 122471 11.9% 19.9%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.41 0.00 47.41 47.17 0.0000 1.2667 5776453.73 5776453.73 0.00 96181.25 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.6 88.15% 109525.67 72 128112 109346.53 0 128112 4553647 4553647 0.00
crit 5.6 11.85% 218758.30 228 256224 213833.74 0 256224 1222806 1222806 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 132296 / 9210
Chaos Bolt 132296 0.9% 4.4 59.73sec 626746 309487 Direct 4.4 0 631148 631148 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.41 4.37 0.00 0.00 2.0253 0.0000 2760930.30 2760930.30 0.00 309486.64 309486.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.37 100.00% 631148.03 596691 716030 631450.65 0 716030 2760930 2760930 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 227469 / 17185
Chaos Barrage 227469 1.8% 4.4 59.69sec 1168229 0 Periodic 148.8 30903 61817 34563 11.8% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.40 0.00 149.55 148.83 0.0000 0.1600 5143834.30 5143834.30 0.00 215016.27 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.2 88.16% 30903.09 157 35232 30861.24 0 35232 4054752 4054752 0.00
crit 17.6 11.84% 61816.69 314 70463 61646.48 0 70463 1089083 1089083 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Norgannon's
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Norgannon's
  • harmful:false
  • if_expr:
 
Berserking 2.1 181.03sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.1 23.36sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.15 0.00 0.00 0.00 0.9824 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Norgannon's
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Norgannon's
  • harmful:false
  • if_expr:
 
Havoc 15.1 20.65sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.07 0.00 0.00 0.00 1.0400 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.3 20.46sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.25 0.00 0.00 0.00 0.9735 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 92.15sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.66 0.00 0.00 0.00 0.9519 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.32sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0580 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7527 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.3sec 78.50% 78.50% 1.4(1.4) 19.3

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.69%
  • accelerando_2:24.56%
  • accelerando_3:14.68%
  • accelerando_4:6.58%
  • accelerando_5:2.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 181.0sec 181.0sec 6.84% 7.39% 0.0(0.0) 2.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.58% 0.0(0.0) 1.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.7 0.0 12.1sec 12.1sec 49.25% 47.99% 0.0(0.0) 0.5

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.25%

Trigger Attempt Success

  • trigger_pct:49.92%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.4sec 69.4sec 8.77% 8.77% 0.0(0.0) 3.3

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.77%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.0 33.5 11.8sec 5.0sec 59.67% 67.51% 33.5(33.5) 25.4

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 6.9 8.4 45.1sec 20.5sec 97.94% 96.44% 47.8(47.8) 5.9

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:97.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.93% 97.93% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.7sec 69.1sec 13.65% 13.65% 0.0(0.0) 3.4

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.65%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 128.4sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 121.3sec 121.3sec 17.73% 17.73% 0.0(0.0) 2.7

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.4 59.0sec
chaos_tear 4.4 59.1sec
chaos_portal 4.4 59.2sec
dimension_ripper 4.0 54.0sec

Resources

Resource Usage Type Count Total Average RPE APR
Norgannon's
chaos_bolt Soul Shard 59.5 119.0 2.0 2.0 741625.9
havoc Mana 15.1 1326430.9 88000.0 87999.8 0.0
immolate Mana 20.3 1340275.7 66000.0 66000.3 56.1
incinerate Mana 80.0 5278409.9 66000.0 66000.1 7.4
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 111.3 4453.4 40.0 40.0 2808.9
pet - service_imp
firebolt Energy 49.2 1969.6 40.0 40.0 5732.2
pet - doomguard
doom_bolt Energy 11.0 385.4 35.0 35.0 6049.9
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.25 3675932.52 (47.09%) 241039.62 1356674.70 26.96%
immolate Soul Shard 65.82 65.10 (52.77%) 0.99 0.72 1.09%
conflagrate Soul Shard 49.46 49.39 (40.04%) 1.00 0.07 0.14%
mp5_regen Mana 492.89 4130100.73 (52.91%) 8379.28 615733.00 12.97%
soulsnatcher Soul Shard 8.88 8.88 (7.20%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1876.77 4287.48 (100.00%) 2.28 22.80 0.53%
pet - service_imp
energy_regen Energy 434.39 1373.86 (100.00%) 3.16 63.76 4.44%
pet - doomguard
energy_regen Energy 11.01 350.27 (100.00%) 31.81 45.65 11.53%
Resource RPS-Gain RPS-Loss
Health 0.00 16102.90
Mana 25923.95 26385.69
Soul Shard 0.41 0.41
Combat End Resource Mean Min Max
Mana 956717.82 408174.74 1100000.00
Soul Shard 1.76 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 12.0%

Statistics & Data Analysis

Fight Length
Sample Data Norgannon's Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Norgannon's Damage Per Second
Count 9999
Mean 973391.20
Minimum 878786.86
Maximum 1107993.16
Spread ( max - min ) 229206.30
Range [ ( max - min ) / 2 * 100% ] 11.77%
Standard Deviation 31500.3830
5th Percentile 924486.16
95th Percentile 1027744.67
( 95th Percentile - 5th Percentile ) 103258.51
Mean Distribution
Standard Deviation 315.0196
95.00% Confidence Intervall ( 972773.78 - 974008.63 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4024
0.1 Scale Factor Error with Delta=300 8470623
0.05 Scale Factor Error with Delta=300 33882491
0.01 Scale Factor Error with Delta=300 847062267
Priority Target DPS
Sample Data Norgannon's Priority Target Damage Per Second
Count 9999
Mean 562361.24
Minimum 502713.15
Maximum 634754.61
Spread ( max - min ) 132041.46
Range [ ( max - min ) / 2 * 100% ] 11.74%
Standard Deviation 18864.5281
5th Percentile 532914.81
95th Percentile 594496.34
( 95th Percentile - 5th Percentile ) 61581.53
Mean Distribution
Standard Deviation 188.6547
95.00% Confidence Intervall ( 561991.49 - 562731.00 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4323
0.1 Scale Factor Error with Delta=300 3037915
0.05 Scale Factor Error with Delta=300 12151659
0.01 Scale Factor Error with Delta=300 303791459
DPS(e)
Sample Data Norgannon's Damage Per Second (Effective)
Count 9999
Mean 973391.20
Minimum 878786.86
Maximum 1107993.16
Spread ( max - min ) 229206.30
Range [ ( max - min ) / 2 * 100% ] 11.77%
Damage
Sample Data Norgannon's Damage
Count 9999
Mean 241922757.58
Minimum 174200439.78
Maximum 317565832.34
Spread ( max - min ) 143365392.55
Range [ ( max - min ) / 2 * 100% ] 29.63%
DTPS
Sample Data Norgannon's Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Norgannon's Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Norgannon's Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Norgannon's Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Norgannon's Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Norgannon's Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Norgannon'sTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Norgannon's Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 15.07 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.23 immolate,if=remains<=tick_time
F 0.71 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.40 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 14.05 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 35.41 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
L 14.25 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
M 3.66 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.89 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 12.15 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 58.80 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 80.32 incinerate
T 0.00 life_tap

Sample Sequence

01269ABCDEGHJMKNKPQQRRKRRKSQSSRKLCSSQSESRSGJKKRRSKRLCRKRSQRSSSESSSSLCGJRKKRKRSSSKRLCRSESSRSQRSGJMLRCJRRKRKRKRSSSELSSCSSSGJKPIRRKRQKRSLQSSSCKRSSESRSSSRLSSGJKCRRKRKRRSSKSSSLSQSSCEHSSSMSSSSGJKRKLRKCRSQKRRSSSESSLSSCSQSGJKKQRRRSKOSLSKRCSSESPSSRSSGJKLRCKKRSQRSSSJSQMSSSEJLCRJRSRJSS

Sample Sequence Table

time name target resources buffs
Pre flask Norgannon's 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Norgannon's 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Norgannon's 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.089 dimensional_rift Fluffy_Pillow 1033014.4/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.936 immolate Fluffy_Pillow 1049596.4/1100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:02.781 immolate Fluffy_Pillow 1000139.2/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.628 berserking Fluffy_Pillow 950721.1/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.628 conflagrate Fluffy_Pillow 950721.1/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:04.383 service_imp Fluffy_Pillow 967719.1/1100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:05.137 conflagrate Fluffy_Pillow 984694.5/1100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:05.890 summon_infernal Fluffy_Pillow 1001647.5/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:06.645 conflagrate Fluffy_Pillow 1018645.4/1100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:07.399 soul_harvest Fluffy_Pillow 1035636.0/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:07.399 dimensional_rift Fluffy_Pillow 1035636.0/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:08.155 dimensional_rift Fluffy_Pillow 1052899.8/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:08.907 chaos_bolt Fluffy_Pillow 1070105.8/1100000: 97% mana | 5.0/5: 100% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4), potion_of_deadly_grace
0:09.849 chaos_bolt Fluffy_Pillow 1091920.8/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_deadly_grace
0:10.603 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_deadly_grace
0:11.358 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_deadly_grace
0:12.119 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:12.874 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
0:13.621 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:14.486 dimensional_rift Fluffy_Pillow 1039383.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:15.240 incinerate Fluffy_Pillow 1053933.8/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:15.993 incinerate Fluffy_Pillow 1002464.4/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:16.748 chaos_bolt Fluffy_Pillow 951033.7/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, devils_due, accelerando, potion_of_deadly_grace
0:18.767 conflagrate Fluffy_Pillow 990371.0/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
0:19.764 life_tap Fluffy_Pillow 1009889.5/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
0:20.762 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
0:21.746 incinerate Fluffy_Pillow 1031539.5/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(3), potion_of_deadly_grace
0:22.924 incinerate Fluffy_Pillow 988931.2/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, devils_due, accelerando(3), potion_of_deadly_grace
0:24.102 dimensional_rift Fluffy_Pillow 946323.0/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, devils_due, accelerando(3), potion_of_deadly_grace
0:25.087 incinerate Fluffy_Pillow 965862.1/1100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
0:26.131 immolate Fluffy_Pillow 919715.9/1100000: 84% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
0:27.002 incinerate Fluffy_Pillow 870279.8/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, potion_of_deadly_grace
0:28.048 chaos_bolt Fluffy_Pillow 824171.7/1100000: 75% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames
0:29.789 incinerate Fluffy_Pillow 857280.5/1100000: 78% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:30.834 immolate Fluffy_Pillow 811154.5/1100000: 74% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:31.693 conflagrate Fluffy_Pillow 761730.6/1100000: 69% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:32.553 conflagrate Fluffy_Pillow 778326.0/1100000: 71% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:33.411 conflagrate Fluffy_Pillow 794882.8/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:34.271 chaos_bolt Fluffy_Pillow 811478.2/1100000: 74% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando
0:35.986 chaos_bolt Fluffy_Pillow 844572.6/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:37.018 incinerate Fluffy_Pillow 864487.1/1100000: 79% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:38.049 conflagrate Fluffy_Pillow 818382.3/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:38.908 chaos_bolt Fluffy_Pillow 834958.4/1100000: 76% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:39.938 life_tap Fluffy_Pillow 855078.1/1100000: 78% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:40.785 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:41.821 chaos_bolt Fluffy_Pillow 1027601.6/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:43.139 conflagrate Fluffy_Pillow 1047401.2/1100000: 95% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:44.269 chaos_bolt Fluffy_Pillow 1063931.4/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:45.626 incinerate Fluffy_Pillow 1083782.3/1100000: 99% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:46.984 dimensional_rift Fluffy_Pillow 1034073.1/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:48.118 chaos_bolt Fluffy_Pillow 1050661.9/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:49.475 incinerate Fluffy_Pillow 1070586.5/1100000: 97% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:50.813 incinerate Fluffy_Pillow 1024448.6/1100000: 93% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:52.132 incinerate Fluffy_Pillow 978312.0/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:53.451 immolate Fluffy_Pillow 932175.4/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:54.550 incinerate Fluffy_Pillow 882725.7/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
0:55.869 incinerate Fluffy_Pillow 836589.1/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
0:57.189 incinerate Fluffy_Pillow 790467.6/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
0:58.508 incinerate Fluffy_Pillow 744331.0/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
0:59.827 life_tap Fluffy_Pillow 698195.5/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:00.912 havoc enemy2 1044768.6/1100000: 95% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:02.035 immolate Fluffy_Pillow 973339.2/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
1:03.166 conflagrate Fluffy_Pillow 923884.1/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
1:04.299 chaos_bolt Fluffy_Pillow 940458.2/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
1:06.559 conflagrate Fluffy_Pillow 973518.7/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:07.692 conflagrate Fluffy_Pillow 990092.8/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:08.824 chaos_bolt Fluffy_Pillow 1006652.3/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:10.182 conflagrate Fluffy_Pillow 1026519.0/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:11.296 chaos_bolt Fluffy_Pillow 1043055.0/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:12.634 incinerate Fluffy_Pillow 1062917.1/1100000: 97% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:13.953 incinerate Fluffy_Pillow 1016780.5/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:15.271 incinerate Fluffy_Pillow 970628.9/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:16.591 conflagrate Fluffy_Pillow 924507.3/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:17.755 chaos_bolt Fluffy_Pillow 942036.5/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:19.952 life_tap Fluffy_Pillow 975224.2/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:21.039 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:22.124 chaos_bolt Fluffy_Pillow 1028573.1/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:23.424 incinerate Fluffy_Pillow 1047625.3/1100000: 95% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:24.762 immolate Fluffy_Pillow 1001694.2/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:25.862 incinerate Fluffy_Pillow 952259.6/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:27.181 incinerate Fluffy_Pillow 906123.0/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:28.500 chaos_bolt Fluffy_Pillow 859986.4/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:30.697 incinerate Fluffy_Pillow 893135.5/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:31.999 dimensional_rift Fluffy_Pillow 847023.2/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:33.075 chaos_bolt Fluffy_Pillow 863569.2/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:34.357 incinerate Fluffy_Pillow 883427.9/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:35.640 immolate Fluffy_Pillow 837112.4/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:36.773 conflagrate Fluffy_Pillow 787686.5/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:37.904 service_imp Fluffy_Pillow 804231.4/1100000: 73% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:39.036 life_tap Fluffy_Pillow 820790.9/1100000: 75% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:40.151 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:42.381 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:43.479 conflagrate Fluffy_Pillow 1028535.3/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:44.579 chaos_bolt Fluffy_Pillow 1045100.6/1100000: 95% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:45.897 chaos_bolt Fluffy_Pillow 1064949.0/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:47.215 conflagrate Fluffy_Pillow 1084797.3/1100000: 99% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:48.313 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:49.630 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:50.713 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:52.012 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:53.144 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:54.499 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:55.856 incinerate Fluffy_Pillow 1034058.5/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:57.212 incinerate Fluffy_Pillow 987984.2/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:58.550 immolate Fluffy_Pillow 941845.2/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:59.665 life_tap Fluffy_Pillow 892396.1/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:00.771 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:02.088 incinerate Fluffy_Pillow 1034045.8/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
2:03.388 havoc enemy2 987903.9/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
2:04.458 incinerate Fluffy_Pillow 916478.5/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
2:05.741 incinerate Fluffy_Pillow 870616.0/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(5)
2:07.006 incinerate Fluffy_Pillow 824483.6/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(5)
2:08.271 immolate Fluffy_Pillow 778351.3/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(5)
2:09.363 conflagrate Fluffy_Pillow 728901.2/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:10.479 conflagrate Fluffy_Pillow 745467.0/1100000: 68% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:11.579 soul_harvest Fluffy_Pillow 762032.3/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:11.579 potion Fluffy_Pillow 762032.3/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:11.579 chaos_bolt Fluffy_Pillow 762032.3/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:13.775 chaos_bolt Fluffy_Pillow 795260.9/1100000: 72% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:14.630 conflagrate Fluffy_Pillow 808320.8/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:15.384 chaos_bolt Fluffy_Pillow 819838.0/1100000: 75% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:16.241 dimensional_rift Fluffy_Pillow 832928.4/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:16.995 conflagrate Fluffy_Pillow 844445.6/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:17.750 chaos_bolt Fluffy_Pillow 855978.0/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:18.606 incinerate Fluffy_Pillow 869053.2/1100000: 79% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:19.461 life_tap Fluffy_Pillow 816113.1/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:20.214 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:20.968 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_deadly_grace
2:21.812 incinerate Fluffy_Pillow 1034059.4/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:22.692 incinerate Fluffy_Pillow 981122.0/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:23.571 havoc enemy2 928169.7/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:24.326 conflagrate Fluffy_Pillow 851376.8/1100000: 77% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:25.078 chaos_bolt Fluffy_Pillow 862539.4/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_deadly_grace
2:27.701 incinerate Fluffy_Pillow 902003.4/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:29.255 incinerate Fluffy_Pillow 859405.8/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:30.808 immolate Fluffy_Pillow 816870.2/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3), potion_of_deadly_grace
2:32.085 incinerate Fluffy_Pillow 770376.0/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3), potion_of_deadly_grace
2:33.616 chaos_bolt Fluffy_Pillow 727761.6/1100000: 66% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:35.778 incinerate Fluffy_Pillow 759512.6/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:36.672 incinerate Fluffy_Pillow 706590.5/1100000: 64% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:37.566 incinerate Fluffy_Pillow 653668.4/1100000: 59% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:38.459 chaos_bolt Fluffy_Pillow 600731.7/1100000: 55% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:39.353 life_tap Fluffy_Pillow 613809.6/1100000: 56% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:40.108 incinerate Fluffy_Pillow 954854.2/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:41.003 incinerate Fluffy_Pillow 901946.7/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:41.896 immolate Fluffy_Pillow 849161.1/1100000: 77% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:42.651 conflagrate Fluffy_Pillow 794368.2/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:43.405 conflagrate Fluffy_Pillow 805560.5/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando
2:44.149 havoc enemy2 816764.7/1100000: 74% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
2:44.905 chaos_bolt Fluffy_Pillow 740149.6/1100000: 67% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
2:46.349 chaos_bolt Fluffy_Pillow 761895.5/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:47.218 conflagrate Fluffy_Pillow 774982.1/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:47.973 chaos_bolt Fluffy_Pillow 786352.0/1100000: 71% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
2:49.528 conflagrate Fluffy_Pillow 809769.4/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
2:51.048 chaos_bolt Fluffy_Pillow 832659.8/1100000: 76% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
2:52.602 chaos_bolt Fluffy_Pillow 856063.2/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(3)
2:54.134 incinerate Fluffy_Pillow 878856.7/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
2:55.734 incinerate Fluffy_Pillow 836262.3/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
2:56.629 conflagrate Fluffy_Pillow 783430.2/1100000: 71% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:57.384 incinerate Fluffy_Pillow 794637.3/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:58.266 incinerate Fluffy_Pillow 741729.6/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
2:59.147 incinerate Fluffy_Pillow 688807.0/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:00.028 life_tap Fluffy_Pillow 635884.5/1100000: 58% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:00.782 incinerate Fluffy_Pillow 977076.7/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:01.664 dimensional_rift Fluffy_Pillow 924169.0/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:02.419 incinerate Fluffy_Pillow 935376.1/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:03.299 incinerate Fluffy_Pillow 882439.5/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:04.167 havoc enemy2 829511.1/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:04.921 immolate Fluffy_Pillow 752865.9/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:05.676 berserking Fluffy_Pillow 698235.8/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:05.676 incinerate Fluffy_Pillow 698235.8/1100000: 63% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:06.433 incinerate Fluffy_Pillow 645345.8/1100000: 59% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:07.189 incinerate Fluffy_Pillow 592438.5/1100000: 54% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:07.945 service_imp Fluffy_Pillow 539531.2/1100000: 49% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
3:09.095 incinerate Fluffy_Pillow 559042.9/1100000: 51% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due
3:10.487 incinerate Fluffy_Pillow 516461.7/1100000: 47% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:11.856 incinerate Fluffy_Pillow 473831.1/1100000: 43% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:13.225 incinerate Fluffy_Pillow 431200.5/1100000: 39% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
3:14.593 immolate Fluffy_Pillow 388553.4/1100000: 35% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
3:15.719 conflagrate Fluffy_Pillow 342035.5/1100000: 31% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:16.802 conflagrate Fluffy_Pillow 358578.1/1100000: 33% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:17.888 chaos_bolt Fluffy_Pillow 375166.5/1100000: 34% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:20.054 conflagrate Fluffy_Pillow 408251.6/1100000: 37% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:21.139 life_tap Fluffy_Pillow 424824.7/1100000: 39% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:22.218 chaos_bolt Fluffy_Pillow 771368.6/1100000: 70% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
3:23.501 conflagrate Fluffy_Pillow 790363.7/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:24.633 havoc enemy2 806923.2/1100000: 73% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:25.766 chaos_bolt Fluffy_Pillow 735497.3/1100000: 67% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:27.122 incinerate Fluffy_Pillow 755501.4/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:28.460 dimensional_rift Fluffy_Pillow 709362.4/1100000: 64% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:29.575 conflagrate Fluffy_Pillow 725913.3/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:30.718 chaos_bolt Fluffy_Pillow 743117.0/1100000: 68% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:32.035 chaos_bolt Fluffy_Pillow 762950.9/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:33.334 incinerate Fluffy_Pillow 782792.8/1100000: 71% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:34.634 incinerate Fluffy_Pillow 736650.8/1100000: 67% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
3:35.917 incinerate Fluffy_Pillow 690691.8/1100000: 63% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
3:37.182 immolate Fluffy_Pillow 644559.4/1100000: 59% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
3:38.237 incinerate Fluffy_Pillow 595128.9/1100000: 54% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(5)
3:39.503 incinerate Fluffy_Pillow 547762.8/1100000: 50% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames
3:40.861 life_tap Fluffy_Pillow 501629.4/1100000: 46% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:41.976 incinerate Fluffy_Pillow 848180.3/1100000: 77% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:43.315 incinerate Fluffy_Pillow 802057.5/1100000: 73% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:44.634 havoc enemy2 755920.9/1100000: 69% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
3:45.387 incinerate Fluffy_Pillow 679260.7/1100000: 62% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
3:46.256 dimensional_rift Fluffy_Pillow 626347.3/1100000: 57% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
3:47.008 incinerate Fluffy_Pillow 637672.0/1100000: 58% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
3:47.876 immolate Fluffy_Pillow 584743.6/1100000: 53% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
3:48.630 conflagrate Fluffy_Pillow 530098.4/1100000: 48% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
3:49.383 conflagrate Fluffy_Pillow 541438.2/1100000: 49% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
3:50.137 conflagrate Fluffy_Pillow 552793.0/1100000: 50% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:50.891 dimensional_rift Fluffy_Pillow 564147.8/1100000: 51% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
3:51.646 chaos_bolt Fluffy_Pillow 575517.7/1100000: 52% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
3:53.091 chaos_bolt Fluffy_Pillow 597334.5/1100000: 54% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:53.970 chaos_bolt Fluffy_Pillow 610382.2/1100000: 55% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:54.851 incinerate Fluffy_Pillow 623459.7/1100000: 57% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
3:55.732 conflagrate Fluffy_Pillow 570538.2/1100000: 52% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
3:57.027 summon_doomguard Fluffy_Pillow 590040.1/1100000: 54% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
3:58.322 incinerate Fluffy_Pillow 609542.1/1100000: 55% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
3:59.875 life_tap Fluffy_Pillow 567223.5/1100000: 52% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(3)
4:01.152 incinerate Fluffy_Pillow 916729.4/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(3)
4:02.682 conflagrate Fluffy_Pillow 874099.7/1100000: 79% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(3)
4:03.958 chaos_bolt Fluffy_Pillow 893590.3/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:06.123 havoc enemy2 925994.5/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:07.240 incinerate Fluffy_Pillow 854575.1/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:08.579 incinerate Fluffy_Pillow 808451.0/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:09.916 immolate Fluffy_Pillow 762297.2/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:11.032 incinerate Fluffy_Pillow 712862.9/1100000: 65% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:12.369 soul_harvest Fluffy_Pillow 666789.6/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:12.369 incinerate Fluffy_Pillow 666789.6/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:13.687 incinerate Fluffy_Pillow 620637.9/1100000: 56% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:15.007 chaos_bolt Fluffy_Pillow 574517.7/1100000: 52% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:17.171 incinerate Fluffy_Pillow 607572.2/1100000: 55% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:18.471 incinerate Fluffy_Pillow 560993.2/1100000: 51% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:19.829 immolate Fluffy_Pillow 514858.7/1100000: 47% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:20.961 conflagrate Fluffy_Pillow 465418.2/1100000: 42% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:22.091 conflagrate Fluffy_Pillow 481948.5/1100000: 44% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames
4:23.222 life_tap Fluffy_Pillow 498493.3/1100000: 45% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:24.353 chaos_bolt Fluffy_Pillow 845038.2/1100000: 77% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos
4:26.612 havoc enemy2 878365.9/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:27.727 conflagrate Fluffy_Pillow 806916.8/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:28.482 conflagrate Fluffy_Pillow 818123.9/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:29.375 chaos_bolt Fluffy_Pillow 831379.4/1100000: 76% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:30.255 incinerate Fluffy_Pillow 844442.0/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:31.135 dimensional_rift Fluffy_Pillow 791504.6/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:31.888 chaos_bolt Fluffy_Pillow 802682.0/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:32.767 incinerate Fluffy_Pillow 815729.7/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:33.647 incinerate Fluffy_Pillow 762793.2/1100000: 69% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:34.517 incinerate Fluffy_Pillow 709894.9/1100000: 65% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:35.386 conflagrate Fluffy_Pillow 656981.6/1100000: 60% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:36.141 incinerate Fluffy_Pillow 668351.4/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:37.008 dimensional_rift Fluffy_Pillow 615408.0/1100000: 56% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
4:37.775 service_imp Fluffy_Pillow 626755.2/1100000: 57% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact
4:38.701 incinerate Fluffy_Pillow 640301.2/1100000: 58% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact
4:39.597 incinerate Fluffy_Pillow 587408.4/1100000: 53% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, devils_due
4:41.195 incinerate Fluffy_Pillow 544784.8/1100000: 50% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, devils_due
4:42.793 immolate Fluffy_Pillow 502197.5/1100000: 46% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando
4:44.106 conflagrate Fluffy_Pillow 455687.5/1100000: 41% mana | 0.0/5: 0% soul_shard lord_of_flames, devils_due, accelerando
4:45.418 life_tap Fluffy_Pillow 475162.6/1100000: 43% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando
4:46.732 havoc enemy2 824667.4/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
4:48.043 chaos_bolt Fluffy_Pillow 756127.7/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:50.272 conflagrate Fluffy_Pillow 789215.9/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:51.372 chaos_bolt Fluffy_Pillow 805781.3/1100000: 73% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:52.691 incinerate Fluffy_Pillow 825644.7/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:54.009 chaos_bolt Fluffy_Pillow 779493.0/1100000: 71% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:55.327 conflagrate Fluffy_Pillow 799038.5/1100000: 73% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:56.559 incinerate Fluffy_Pillow 817060.8/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:57.917 incinerate Fluffy_Pillow 770927.4/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52991 52991 34504
Intellect 50379 48673 39032 (1278)
Spirit 1 1 0
Health 3179460 3179460 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50379 48673 0
Crit 11.78% 11.78% 2713
Haste 32.99% 31.99% 11995
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14629 14519 0
Mastery 69.12% 69.12% 6014
Armor 1979 1979 1979
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Norgannon's Foresight
ilevel: 940, stats: { 247 Armor, +3544 Sta, +2362 Int, +822 Haste, +617 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Norgannon's"
level=110
race=troll
role=spell
position=back
talents=2303021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=norgannons_foresight,id=132455,ilevel=940
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.60
# gear_stamina=34504
# gear_intellect=39032
# gear_crit_rating=2713
# gear_haste_rating=11995
# gear_mastery_rating=6014
# gear_versatility_rating=2829
# gear_armor=1979
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Odr : 970892 dps, 562311 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
970892.2 970892.2 629.5 / 0.065% 124124.6 / 12.8% 31.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
25617.0 25617.0 Mana 0.00% 51.4 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Odr 970892
Chaos Bolt 295929 30.5% 58.1 5.03sec 1533340 1025398 Direct 111.5 0 798685 798685 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.05 111.45 0.00 0.00 1.4954 0.0000 89014828.80 89014828.80 0.00 1025398.33 1025398.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 111.45 100.00% 798685.05 522276 1155755 799059.89 743445 846136 89014829 89014829 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 108981 11.2% 48.6 6.18sec 674151 653155 Direct 97.1 197595 448437 337201 55.7%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.58 97.12 0.00 0.00 1.0322 0.0000 32747873.93 32747873.93 0.00 653154.77 653154.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.07 44.35% 197594.53 129878 287569 197658.72 174199 224520 8509820 8509820 0.00
crit 54.05 55.65% 448436.74 259825 708875 448536.23 410225 496046 24238054 24238054 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 13828 1.4% 32.8 5.04sec 124682 0 Direct 32.8 107769 215385 124681 15.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.76 32.76 0.00 0.00 0.0000 0.0000 4084951.18 4084951.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.61 84.28% 107769.02 86776 114544 107769.69 103263 112726 2975950 2975950 0.00
crit 5.15 15.72% 215385.26 173552 229088 214443.45 0 229088 1109001 1109001 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 246445 25.4% 20.0 15.25sec 3710262 3539891 Direct 38.8 135453 270814 200003 47.7%  
Periodic 298.3 150479 301170 222283 47.6% 196.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.96 38.80 298.31 298.31 1.0481 1.9854 74068686.75 74068686.75 0.00 120791.60 3539891.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.30 52.31% 135452.50 90111 207187 135409.24 115494 156187 2749322 2749322 0.00
crit 18.50 47.69% 270814.32 180230 416569 270774.23 229472 318757 5011239 5011239 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 156.2 52.35% 150479.41 66 412020 150654.46 130865 173811 23499831 23499831 0.00
crit 142.1 47.65% 301169.53 132 824040 301522.44 261892 346965 42808294 42808294 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 126405 13.1% 76.7 3.73sec 496230 410719 Direct 148.0 222415 444410 257344 15.7%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.73 147.96 0.00 0.00 1.2082 0.0000 38077728.85 38077728.85 0.00 410718.68 410718.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 124.68 84.26% 222414.66 145659 322336 222373.27 209433 237412 27730518 27730518 0.00
crit 23.28 15.74% 444410.38 291439 644662 444337.50 382892 522245 10347211 10347211 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9666 1.0% 20.0 14.86sec 145093 0 Direct 20.0 125380 250581 145094 15.7%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.04 20.04 0.00 0.00 0.0000 0.0000 2907369.42 2907369.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.88 84.25% 125379.93 110245 145524 125392.79 119065 135129 2116751 2116751 0.00
crit 3.16 15.75% 250581.47 220490 291047 240095.01 0 291047 790618 790618 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 41883 / 41883
Firebolt 41883 4.3% 109.0 2.76sec 115476 92814 Direct 108.2 100582 201237 116368 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.05 108.21 0.00 0.00 1.2442 0.0000 12592352.16 12592352.16 0.00 92813.99 92813.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.24 84.32% 100581.53 65046 117083 100585.87 98570 102773 9176915 9176915 0.00
crit 16.97 15.68% 201236.95 130092 234165 201244.62 178876 226360 3415437 3415437 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 121035 / 38555
Firebolt 121035 4.0% 49.2 5.52sec 234926 200113 Direct 48.9 204172 408077 236178 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.21 48.95 0.00 0.00 1.1740 0.0000 11560740.33 11560740.33 0.00 200113.21 200113.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.27 84.30% 204171.64 130092 234165 204324.14 198163 210993 8425159 8425159 0.00
crit 7.68 15.70% 408077.00 260184 468331 408257.69 0 468331 3135582 3135582 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 105962 / 8966
Immolation 81590 0.7% 1.0 0.00sec 2039839 0 Periodic 44.1 39968 79939 46227 15.7% 8.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.06 44.13 0.0000 1.0979 2039838.91 2039838.91 0.00 84210.83 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.2 84.34% 39967.67 34452 41342 39967.82 39107 40798 1487355 1487355 0.00
crit 6.9 15.66% 79939.21 68903 82684 79882.75 0 82684 552484 552484 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24372 0.2% 22.1 1.10sec 27618 25155 Direct 22.1 23902 47793 27618 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.06 22.06 0.00 0.00 1.0979 0.0000 609324.46 895764.67 31.98 25154.79 25154.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.63 84.45% 23901.77 20602 24723 23902.03 23251 24723 445312 654650 31.98
crit 3.43 15.55% 47793.12 41204 49445 46664.24 0 49445 164013 241114 31.22
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 94948 / 8025
Doom Bolt 94948 0.8% 10.9 2.25sec 217711 97003 Direct 10.9 188108 376020 217725 15.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.90 10.90 0.00 0.00 2.2444 0.0000 2373765.95 2373765.95 0.00 97003.23 97003.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.18 84.24% 188107.92 181906 218287 188094.46 181906 218287 1727565 1727565 0.00
crit 1.72 15.76% 376019.77 363812 436574 317432.07 0 436574 646201 646201 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 105981 / 8969
Immolation 81583 0.7% 1.0 0.00sec 2039656 0 Periodic 44.1 39966 79960 46224 15.6% 8.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.06 44.13 0.0000 1.0979 2039655.61 2039655.61 0.00 84203.26 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.2 84.35% 39965.72 34452 41342 39966.08 39176 40924 1487538 1487538 0.00
crit 6.9 15.65% 79960.21 68903 82684 79923.14 0 82684 552117 552117 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24398 0.2% 22.1 1.10sec 27647 25181 Direct 22.1 23901 47804 27647 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.06 22.06 0.00 0.00 1.0979 0.0000 609965.25 896706.70 31.98 25181.24 25181.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 84.33% 23900.80 20602 24723 23901.01 23138 24723 444671 653708 31.98
crit 3.46 15.67% 47803.68 41204 49445 46680.50 0 49445 165294 242999 31.23
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 106000 / 8970
Immolation 81603 0.7% 1.0 0.00sec 2040161 0 Periodic 44.1 39970 79909 46235 15.7% 8.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.06 44.13 0.0000 1.0979 2040161.41 2040161.41 0.00 84224.14 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.2 84.31% 39970.47 34452 41342 39970.85 39119 40948 1487032 1487032 0.00
crit 6.9 15.69% 79909.05 68903 82684 79856.53 0 82684 553129 553129 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24397 0.2% 22.1 1.10sec 27646 25181 Direct 22.1 23902 47794 27647 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.06 22.06 0.00 0.00 1.0979 0.0000 609952.89 896688.52 31.98 25180.73 25180.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 84.33% 23901.66 20602 24723 23901.97 23138 24723 444683 653726 31.98
crit 3.46 15.67% 47794.44 41204 49445 46647.62 0 49445 165270 242962 31.21
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 106023 / 8972
Immolation 81624 0.7% 1.0 0.00sec 2040683 0 Periodic 44.1 39968 79936 46248 15.7% 8.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.06 44.13 0.0000 1.0979 2040683.06 2040683.06 0.00 84245.68 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.2 84.29% 39967.95 34452 41342 39968.08 39119 41133 1486511 1486511 0.00
crit 6.9 15.71% 79936.19 68903 82684 79887.89 0 82684 554172 554172 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24399 0.2% 22.1 1.10sec 27648 25182 Direct 22.1 23905 47762 27648 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.06 22.06 0.00 0.00 1.0979 0.0000 609995.33 896750.92 31.98 25182.49 25182.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 84.31% 23904.71 20602 24723 23905.27 23251 24723 444641 653664 31.98
crit 3.46 15.69% 47761.64 41204 49445 46729.71 0 49445 165355 243087 31.28
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 113613 / 19284
Shadow Bolt 113613 2.0% 4.4 59.16sec 1317197 0 Periodic 46.5 107312 214948 124252 15.7% 19.8%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.39 0.00 46.74 46.49 0.0000 1.2763 5776851.91 5776851.91 0.00 96837.68 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.2 84.26% 107312.36 72 127207 107183.50 0 127207 4203969 4203969 0.00
crit 7.3 15.74% 214948.11 218 254414 212375.15 0 254414 1572882 1572882 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 135746 / 9367
Chaos Bolt 135746 1.0% 4.4 58.94sec 644102 311418 Direct 4.3 0 648008 648008 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 4.33 0.00 0.00 2.0685 0.0000 2806500.00 2806500.00 0.00 311418.11 311418.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.33 100.00% 648008.19 613122 735746 648229.72 0 735746 2806500 2806500 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 229664 / 16981
Chaos Barrage 229664 1.7% 4.3 59.66sec 1178417 0 Periodic 143.2 30652 61296 35466 15.7% 7.8%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 0.00 143.95 143.23 0.0000 0.1627 5079945.47 5079945.47 0.00 216897.04 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.7 84.29% 30651.97 152 34983 30608.62 0 34983 3700749 3700749 0.00
crit 22.5 15.71% 61296.41 304 69966 61196.59 0 69966 1379196 1379196 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Odr
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Odr
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.74sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.0 23.50sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.99 0.00 0.00 0.00 0.9984 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Odr
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Odr
  • harmful:false
  • if_expr:
 
Havoc 15.1 20.68sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.13 0.00 0.00 0.00 1.0602 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.2 20.53sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.19 0.00 0.00 0.00 0.9957 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 92.00sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 0.9671 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.03sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0745 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7551 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.52% 78.52% 1.4(1.4) 19.3

Buff details

  • buff initial source:Odr
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.72%
  • accelerando_2:24.69%
  • accelerando_3:14.70%
  • accelerando_4:6.52%
  • accelerando_5:2.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.84% 7.45% 0.0(0.0) 2.0

Buff details

  • buff initial source:Odr
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.62% 0.0(0.0) 1.0

Buff details

  • buff initial source:Odr
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.3 0.0 12.3sec 12.3sec 49.27% 47.37% 0.0(0.0) 0.8

Buff details

  • buff initial source:Odr
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.27%

Trigger Attempt Success

  • trigger_pct:50.02%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.2sec 69.2sec 8.70% 8.70% 0.0(0.0) 3.2

Buff details

  • buff initial source:Odr
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.70%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.2 32.9 11.7sec 5.0sec 59.60% 67.52% 32.9(32.9) 25.6

Buff details

  • buff initial source:Odr
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 8.1 7.1 37.6sec 20.5sec 97.55% 95.82% 50.8(50.8) 7.1

Buff details

  • buff initial source:Odr
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:97.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.91% 97.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:Odr
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.5sec 68.7sec 13.54% 13.54% 0.0(0.0) 3.3

Buff details

  • buff initial source:Odr
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.54%

Trigger Attempt Success

  • trigger_pct:99.93%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 127.8sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Odr
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 121.0sec 121.0sec 17.76% 17.76% 0.0(0.0) 2.7

Buff details

  • buff initial source:Odr
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Odr
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Odr
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Odr
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.3 59.1sec
chaos_tear 4.4 58.9sec
chaos_portal 4.3 60.0sec
dimension_ripper 3.8 55.1sec

Resources

Resource Usage Type Count Total Average RPE APR
Odr
chaos_bolt Soul Shard 59.1 118.1 2.0 2.0 753692.5
havoc Mana 15.1 1331630.1 88000.0 87999.7 0.0
immolate Mana 20.0 1317591.7 66000.0 66001.0 56.2
incinerate Mana 76.7 5064508.6 66000.0 66000.8 7.5
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 109.0 4361.9 40.0 40.0 2886.9
pet - service_imp
firebolt Energy 49.2 1968.5 40.0 40.0 5873.0
pet - doomguard
doom_bolt Energy 10.9 381.6 35.0 35.0 6220.3
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.19 3621316.07 (47.79%) 238444.59 1390474.39 27.74%
immolate Soul Shard 65.97 65.21 (53.20%) 0.99 0.76 1.15%
conflagrate Soul Shard 48.58 48.50 (39.57%) 1.00 0.08 0.16%
mp5_regen Mana 482.63 3955820.29 (52.21%) 8196.40 686558.24 14.79%
soulsnatcher Soul Shard 8.86 8.86 (7.23%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1869.37 4195.81 (100.00%) 2.24 22.81 0.54%
pet - service_imp
energy_regen Energy 425.09 1347.37 (100.00%) 3.17 63.76 4.52%
pet - doomguard
energy_regen Energy 10.90 346.52 (100.00%) 31.78 45.49 11.61%
Resource RPS-Gain RPS-Loss
Health 0.00 15987.54
Mana 25163.68 25617.04
Soul Shard 0.41 0.41
Combat End Resource Mean Min Max
Mana 965796.87 413502.00 1100000.00
Soul Shard 1.80 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 13.7%

Statistics & Data Analysis

Fight Length
Sample Data Odr Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Odr Damage Per Second
Count 9999
Mean 970892.18
Minimum 875821.57
Maximum 1092655.17
Spread ( max - min ) 216833.59
Range [ ( max - min ) / 2 * 100% ] 11.17%
Standard Deviation 32115.2921
5th Percentile 920552.15
95th Percentile 1025127.82
( 95th Percentile - 5th Percentile ) 104575.67
Mean Distribution
Standard Deviation 321.1690
95.00% Confidence Intervall ( 970262.70 - 971521.66 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4204
0.1 Scale Factor Error with Delta=300 8804556
0.05 Scale Factor Error with Delta=300 35218221
0.01 Scale Factor Error with Delta=300 880455520
Priority Target DPS
Sample Data Odr Priority Target Damage Per Second
Count 9999
Mean 562311.14
Minimum 505841.51
Maximum 645361.71
Spread ( max - min ) 139520.20
Range [ ( max - min ) / 2 * 100% ] 12.41%
Standard Deviation 19077.5895
5th Percentile 532550.93
95th Percentile 594514.29
( 95th Percentile - 5th Percentile ) 61963.36
Mean Distribution
Standard Deviation 190.7854
95.00% Confidence Intervall ( 561937.21 - 562685.07 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4422
0.1 Scale Factor Error with Delta=300 3106925
0.05 Scale Factor Error with Delta=300 12427698
0.01 Scale Factor Error with Delta=300 310692427
DPS(e)
Sample Data Odr Damage Per Second (Effective)
Count 9999
Mean 970892.18
Minimum 875821.57
Maximum 1092655.17
Spread ( max - min ) 216833.59
Range [ ( max - min ) / 2 * 100% ] 11.17%
Damage
Sample Data Odr Damage
Count 9999
Mean 240901438.93
Minimum 168035241.75
Maximum 313615531.51
Spread ( max - min ) 145580289.76
Range [ ( max - min ) / 2 * 100% ] 30.22%
DTPS
Sample Data Odr Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Odr Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Odr Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Odr Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Odr Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Odr Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data OdrTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Odr Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 15.05 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.19 immolate,if=remains<=tick_time
F 0.56 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.25 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.87 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.71 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
L 14.19 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
M 3.67 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.89 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
Q 0.08 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
R 11.99 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
S 58.35 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
T 77.04 incinerate
0.00 life_tap

Sample Sequence

01269ABCDEGHJKMKNPRKRSSTKSTTTKTLCSTTSETTTTGJKKSTTKLSCSSTKSRSTTTTRTETTLRCGJSKKSTKSTTTKLSCTESTTRTTTMGJLSSCJKSSKSKSTTTELSTCTPITTGJSKKRSKLSSTCKSTSTETTTSLSGJKCSKSKSTTRSKLRHSTTCEMTTTSGJKKLSTKSCTTKSTTSTETLTTRSRTTCTGJSOKSKKLSSKTTPTCTTTSETTTTTLRGJKKSSCTRTKSTTTTJLMTJESCSJSSST

Sample Sequence Table

time name target resources buffs
Pre flask Odr 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Odr 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Odr 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.106 dimensional_rift Fluffy_Pillow 1032873.1/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.985 immolate Fluffy_Pillow 1049462.0/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.865 immolate Fluffy_Pillow 1000069.9/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.744 berserking Fluffy_Pillow 950658.9/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.744 conflagrate Fluffy_Pillow 950658.9/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:04.509 conflagrate Fluffy_Pillow 967262.0/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, accelerando, potion_of_deadly_grace
0:05.262 service_imp Fluffy_Pillow 983847.4/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:06.015 conflagrate Fluffy_Pillow 1000432.9/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:06.768 summon_infernal Fluffy_Pillow 1017018.3/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:07.523 soul_harvest Fluffy_Pillow 1033647.7/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:07.523 dimensional_rift Fluffy_Pillow 1033647.7/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:08.278 conflagrate Fluffy_Pillow 1050277.2/1100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:09.062 dimensional_rift Fluffy_Pillow 1067545.4/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:09.818 chaos_bolt Fluffy_Pillow 1084196.9/1100000: 99% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:11.319 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:12.209 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:13.140 conflagrate Fluffy_Pillow 1034106.9/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:13.944 chaos_bolt Fluffy_Pillow 1050739.9/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:15.012 incinerate Fluffy_Pillow 1070598.0/1100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:16.065 incinerate Fluffy_Pillow 1024971.1/1100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:17.088 incinerate Fluffy_Pillow 978850.8/1100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:18.110 conflagrate Fluffy_Pillow 932712.1/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:18.952 incinerate Fluffy_Pillow 949310.5/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:19.961 life_tap Fluffy_Pillow 903201.0/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_deadly_grace
0:20.803 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_deadly_grace
0:21.643 chaos_bolt Fluffy_Pillow 1028558.9/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(4), potion_of_deadly_grace
0:23.323 incinerate Fluffy_Pillow 1061678.5/1100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
0:24.318 incinerate Fluffy_Pillow 1015571.5/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
0:25.311 chaos_bolt Fluffy_Pillow 969424.4/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
0:26.304 immolate Fluffy_Pillow 989277.4/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
0:27.142 incinerate Fluffy_Pillow 939843.9/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:28.211 incinerate Fluffy_Pillow 893719.4/1100000: 81% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:29.280 incinerate Fluffy_Pillow 847595.0/1100000: 77% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:30.348 incinerate Fluffy_Pillow 801452.0/1100000: 73% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:31.416 immolate Fluffy_Pillow 755308.9/1100000: 69% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:32.308 conflagrate Fluffy_Pillow 705893.6/1100000: 64% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:33.199 conflagrate Fluffy_Pillow 722459.7/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:34.091 conflagrate Fluffy_Pillow 739044.3/1100000: 67% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames
0:34.969 chaos_bolt Fluffy_Pillow 755614.4/1100000: 69% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
0:36.721 incinerate Fluffy_Pillow 788886.0/1100000: 72% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:37.759 incinerate Fluffy_Pillow 742766.7/1100000: 68% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:38.797 conflagrate Fluffy_Pillow 696647.3/1100000: 63% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:39.664 life_tap Fluffy_Pillow 713252.8/1100000: 65% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:40.419 chaos_bolt Fluffy_Pillow 1057713.2/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:41.222 havoc enemy2 1069543.8/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:41.976 chaos_bolt Fluffy_Pillow 992652.5/1100000: 90% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:42.863 chaos_bolt Fluffy_Pillow 1005720.6/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:43.751 incinerate Fluffy_Pillow 1018803.5/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:44.638 conflagrate Fluffy_Pillow 965872.5/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
0:45.392 chaos_bolt Fluffy_Pillow 977143.5/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
0:46.265 dimensional_rift Fluffy_Pillow 990080.9/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:47.027 chaos_bolt Fluffy_Pillow 1000979.0/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:47.940 incinerate Fluffy_Pillow 1014036.8/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:48.854 incinerate Fluffy_Pillow 961108.9/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:49.767 incinerate Fluffy_Pillow 908166.6/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:50.679 incinerate Fluffy_Pillow 855210.1/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:51.591 dimensional_rift Fluffy_Pillow 802253.6/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
0:52.956 incinerate Fluffy_Pillow 821775.9/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due
0:54.592 immolate Fluffy_Pillow 779241.0/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
0:55.936 incinerate Fluffy_Pillow 732752.3/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
0:57.547 incinerate Fluffy_Pillow 690139.8/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
0:59.158 life_tap Fluffy_Pillow 647527.3/1100000: 59% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
1:00.503 dimensional_rift Fluffy_Pillow 997053.1/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:01.627 havoc enemy2 1013613.0/1100000: 92% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:02.751 immolate Fluffy_Pillow 942172.8/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:03.875 conflagrate Fluffy_Pillow 892732.7/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:04.998 chaos_bolt Fluffy_Pillow 909277.8/1100000: 83% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
1:07.242 conflagrate Fluffy_Pillow 941924.4/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:08.393 conflagrate Fluffy_Pillow 958469.9/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:09.517 chaos_bolt Fluffy_Pillow 975029.7/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:10.864 incinerate Fluffy_Pillow 994875.0/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:12.212 conflagrate Fluffy_Pillow 948735.0/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:13.337 chaos_bolt Fluffy_Pillow 965309.6/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:14.684 incinerate Fluffy_Pillow 985155.8/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:16.013 incinerate Fluffy_Pillow 939022.0/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:17.341 incinerate Fluffy_Pillow 892874.2/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
1:18.649 conflagrate Fluffy_Pillow 846708.5/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
1:19.740 life_tap Fluffy_Pillow 863252.3/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
1:20.881 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
1:23.193 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:24.333 incinerate Fluffy_Pillow 1028549.8/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:25.700 immolate Fluffy_Pillow 982395.9/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:26.822 chaos_bolt Fluffy_Pillow 932926.3/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:28.170 incinerate Fluffy_Pillow 952786.3/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:29.518 incinerate Fluffy_Pillow 906646.3/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:30.865 dimensional_rift Fluffy_Pillow 860491.6/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:32.229 incinerate Fluffy_Pillow 880587.4/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:33.578 incinerate Fluffy_Pillow 834363.0/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:34.946 incinerate Fluffy_Pillow 788222.8/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:36.312 service_imp Fluffy_Pillow 742053.5/1100000: 67% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:37.452 immolate Fluffy_Pillow 758603.3/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:38.592 conflagrate Fluffy_Pillow 709153.1/1100000: 64% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:39.732 life_tap Fluffy_Pillow 725702.9/1100000: 66% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:40.874 chaos_bolt Fluffy_Pillow 1072281.7/1100000: 97% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:43.152 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:44.501 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:45.627 conflagrate Fluffy_Pillow 1028565.6/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:46.785 conflagrate Fluffy_Pillow 1045127.4/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:47.944 chaos_bolt Fluffy_Pillow 1061703.5/1100000: 97% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:49.334 chaos_bolt Fluffy_Pillow 1081584.6/1100000: 98% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:50.702 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:51.842 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:53.208 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:54.347 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:55.713 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:57.060 incinerate Fluffy_Pillow 1034058.9/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:58.409 incinerate Fluffy_Pillow 987933.7/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:59.755 immolate Fluffy_Pillow 941764.3/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:00.878 life_tap Fluffy_Pillow 892310.2/1100000: 81% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(3)
2:02.017 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
2:04.327 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:05.717 havoc enemy2 1034085.8/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:06.875 incinerate Fluffy_Pillow 962647.6/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:08.264 soul_harvest Fluffy_Pillow 916513.1/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:08.264 potion Fluffy_Pillow 916513.1/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:08.264 incinerate Fluffy_Pillow 916513.1/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:09.653 incinerate Fluffy_Pillow 870378.7/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:11.041 immolate Fluffy_Pillow 824391.9/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:12.180 conflagrate Fluffy_Pillow 774927.1/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:13.310 chaos_bolt Fluffy_Pillow 791485.7/1100000: 72% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:15.553 conflagrate Fluffy_Pillow 824687.2/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:16.646 conflagrate Fluffy_Pillow 841261.3/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:17.738 dimensional_rift Fluffy_Pillow 857820.2/1100000: 78% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:18.832 chaos_bolt Fluffy_Pillow 874409.5/1100000: 79% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:20.139 conflagrate Fluffy_Pillow 894229.1/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:21.217 life_tap Fluffy_Pillow 910807.8/1100000: 83% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, embrace_chaos, accelerando(5), potion_of_deadly_grace
2:22.293 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:23.682 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:25.049 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:26.395 havoc enemy2 1034044.8/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:27.504 conflagrate Fluffy_Pillow 962622.5/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:28.612 chaos_bolt Fluffy_Pillow 979185.2/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:29.943 incinerate Fluffy_Pillow 999081.3/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:31.272 chaos_bolt Fluffy_Pillow 952947.5/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:32.601 incinerate Fluffy_Pillow 972813.8/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:33.929 immolate Fluffy_Pillow 926665.1/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
2:35.037 incinerate Fluffy_Pillow 877299.1/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
2:36.347 incinerate Fluffy_Pillow 830495.0/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:37.737 incinerate Fluffy_Pillow 784376.2/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:39.103 chaos_bolt Fluffy_Pillow 738206.9/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:41.381 life_tap Fluffy_Pillow 771277.4/1100000: 70% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:42.522 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:43.892 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:45.033 conflagrate Fluffy_Pillow 1034072.6/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:46.175 conflagrate Fluffy_Pillow 1050651.4/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:47.298 havoc enemy2 1067196.5/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:48.423 chaos_bolt Fluffy_Pillow 995771.1/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:50.666 conflagrate Fluffy_Pillow 1028526.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:51.808 chaos_bolt Fluffy_Pillow 1045105.0/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:53.175 conflagrate Fluffy_Pillow 1064951.1/1100000: 97% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:54.289 chaos_bolt Fluffy_Pillow 1081491.5/1100000: 98% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:55.618 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
2:56.927 incinerate Fluffy_Pillow 1034060.7/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
2:58.236 dimensional_rift Fluffy_Pillow 987937.3/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
2:59.313 chaos_bolt Fluffy_Pillow 1004500.7/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
3:00.603 conflagrate Fluffy_Pillow 1024339.8/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
3:01.679 life_tap Fluffy_Pillow 1040887.8/1100000: 95% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(5)
3:02.764 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:03.921 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:03.921 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos
3:05.129 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos
3:06.336 incinerate Fluffy_Pillow 1034066.8/1100000: 94% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:07.527 havoc enemy2 987950.5/1100000: 90% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:08.520 immolate Fluffy_Pillow 916528.6/1100000: 83% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:09.511 service_imp Fluffy_Pillow 867073.3/1100000: 79% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando
3:10.504 incinerate Fluffy_Pillow 883651.4/1100000: 80% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando
3:11.692 incinerate Fluffy_Pillow 837485.0/1100000: 76% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando
3:12.882 incinerate Fluffy_Pillow 791352.0/1100000: 72% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando
3:14.071 chaos_bolt Fluffy_Pillow 744875.7/1100000: 68% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:16.349 immolate Fluffy_Pillow 777946.2/1100000: 71% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:17.491 conflagrate Fluffy_Pillow 728526.4/1100000: 66% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:18.623 conflagrate Fluffy_Pillow 745078.7/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:19.780 conflagrate Fluffy_Pillow 761626.1/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:20.939 life_tap Fluffy_Pillow 778202.2/1100000: 71% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
3:22.098 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
3:24.408 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:25.777 conflagrate Fluffy_Pillow 1034088.4/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:26.901 chaos_bolt Fluffy_Pillow 1050648.2/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:28.248 havoc enemy2 1070493.5/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:29.368 incinerate Fluffy_Pillow 999065.1/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:30.696 incinerate Fluffy_Pillow 952916.4/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:32.026 conflagrate Fluffy_Pillow 906797.6/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:33.133 chaos_bolt Fluffy_Pillow 923345.3/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:35.345 incinerate Fluffy_Pillow 955707.6/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:36.712 incinerate Fluffy_Pillow 909552.8/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:38.081 chaos_bolt Fluffy_Pillow 863427.1/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:38.980 incinerate Fluffy_Pillow 876478.2/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:39.881 immolate Fluffy_Pillow 823558.3/1100000: 75% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:40.636 incinerate Fluffy_Pillow 768518.9/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:41.538 life_tap Fluffy_Pillow 715613.6/1100000: 65% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:42.292 incinerate Fluffy_Pillow 1056559.7/1100000: 96% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
3:43.190 incinerate Fluffy_Pillow 1003596.7/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:44.079 dimensional_rift Fluffy_Pillow 950694.3/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:44.833 chaos_bolt Fluffy_Pillow 961802.9/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
3:46.308 dimensional_rift Fluffy_Pillow 983534.1/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:47.063 incinerate Fluffy_Pillow 994657.4/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
3:47.949 incinerate Fluffy_Pillow 941448.4/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:48.863 havoc enemy2 888520.5/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:49.626 incinerate Fluffy_Pillow 811433.0/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
3:50.540 immolate Fluffy_Pillow 758505.0/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due
3:51.904 conflagrate Fluffy_Pillow 712013.0/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due
3:53.268 chaos_bolt Fluffy_Pillow 731521.0/1100000: 67% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, devils_due
3:55.990 summon_doomguard Fluffy_Pillow 770871.7/1100000: 70% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando
3:57.333 conflagrate Fluffy_Pillow 790368.5/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando
3:58.657 chaos_bolt Fluffy_Pillow 809875.0/1100000: 74% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:00.004 conflagrate Fluffy_Pillow 829720.3/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:01.128 conflagrate Fluffy_Pillow 846280.1/1100000: 77% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:02.251 life_tap Fluffy_Pillow 862825.2/1100000: 78% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:03.374 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:04.723 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:05.598 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
4:06.389 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
4:07.303 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
4:08.216 soul_harvest Fluffy_Pillow 981129.3/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
4:08.264 incinerate Fluffy_Pillow 981815.8/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact
4:09.180 havoc enemy2 928916.5/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact
4:09.940 incinerate Fluffy_Pillow 851806.9/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando
4:10.840 incinerate Fluffy_Pillow 798911.8/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(2)
4:11.728 incinerate Fluffy_Pillow 745995.7/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3)
4:12.605 chaos_bolt Fluffy_Pillow 693105.3/1100000: 63% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3)
4:14.060 immolate Fluffy_Pillow 714855.1/1100000: 65% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:14.816 incinerate Fluffy_Pillow 660156.0/1100000: 60% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:15.691 incinerate Fluffy_Pillow 607235.7/1100000: 55% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:16.565 incinerate Fluffy_Pillow 554300.5/1100000: 50% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(3)
4:18.129 incinerate Fluffy_Pillow 511679.6/1100000: 47% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, devils_due, accelerando(3)
4:19.694 incinerate Fluffy_Pillow 469074.7/1100000: 43% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, devils_due, accelerando(4)
4:21.235 life_tap Fluffy_Pillow 426442.2/1100000: 39% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, devils_due, accelerando(4)
4:22.565 dimensional_rift Fluffy_Pillow 775987.9/1100000: 71% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, devils_due
4:23.929 immolate Fluffy_Pillow 795495.9/1100000: 72% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
4:25.087 conflagrate Fluffy_Pillow 746147.7/1100000: 68% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando
4:25.840 conflagrate Fluffy_Pillow 757079.3/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando
4:26.596 conflagrate Fluffy_Pillow 768054.4/1100000: 70% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
4:27.345 chaos_bolt Fluffy_Pillow 779007.5/1100000: 71% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
4:28.822 chaos_bolt Fluffy_Pillow 800768.0/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:29.710 havoc enemy2 813850.9/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:30.463 incinerate Fluffy_Pillow 736944.8/1100000: 67% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:31.350 dimensional_rift Fluffy_Pillow 684013.0/1100000: 62% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:32.105 incinerate Fluffy_Pillow 695136.3/1100000: 63% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:32.993 conflagrate Fluffy_Pillow 642219.2/1100000: 58% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
4:33.749 chaos_bolt Fluffy_Pillow 653357.3/1100000: 59% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
4:35.225 incinerate Fluffy_Pillow 675103.2/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:36.112 incinerate Fluffy_Pillow 622232.2/1100000: 57% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:36.987 incinerate Fluffy_Pillow 569106.5/1100000: 52% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
4:38.623 incinerate Fluffy_Pillow 526504.6/1100000: 48% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
4:40.259 conflagrate Fluffy_Pillow 484041.0/1100000: 44% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando
4:41.602 life_tap Fluffy_Pillow 503537.8/1100000: 46% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando
4:42.936 service_imp Fluffy_Pillow 853033.6/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(2)
4:44.260 incinerate Fluffy_Pillow 872540.0/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(2)
4:45.846 conflagrate Fluffy_Pillow 830085.8/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
4:47.162 immolate Fluffy_Pillow 849757.8/1100000: 77% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
4:48.270 chaos_bolt Fluffy_Pillow 800320.4/1100000: 73% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
4:50.483 havoc enemy2 833401.0/1100000: 76% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:51.590 chaos_bolt Fluffy_Pillow 761948.7/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:52.916 conflagrate Fluffy_Pillow 780935.0/1100000: 71% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:54.058 chaos_bolt Fluffy_Pillow 797513.8/1100000: 73% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:55.423 chaos_bolt Fluffy_Pillow 817384.7/1100000: 74% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:56.771 chaos_bolt Fluffy_Pillow 837244.8/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:58.120 incinerate Fluffy_Pillow 857119.5/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52830 52830 34380
Intellect 50293 48587 38950
Spirit 1 1 0
Health 3169800 3169800 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50293 48587 0
Crit 15.68% 15.68% 4271
Haste 30.02% 29.02% 10882
Damage / Heal Versatility 5.39% 5.39% 2559
ManaReg per Second 14302 14192 0
Mastery 67.65% 67.65% 5819
Armor 1975 1975 1975
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Odr, Shawl of the Ymirjar
ilevel: 940, stats: { 179 Armor, +2658 Sta, +1772 Int, +694 Crit, +385 Haste }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Odr"
level=110
race=troll
role=spell
position=back
talents=2303021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=odr_shawl_of_the_ymirjar,id=132375,ilevel=940,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.93
# gear_stamina=34380
# gear_intellect=38950
# gear_crit_rating=4271
# gear_haste_rating=10882
# gear_mastery_rating=5819
# gear_versatility_rating=2559
# gear_armor=1975
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Portal_Pants : 979769 dps, 564938 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
979769.2 979769.2 641.8 / 0.066% 128162.8 / 13.1% 32.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
25242.2 25242.2 Mana 0.00% 50.6 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Portal_Pants 979769
Chaos Bolt 300695 30.7% 56.8 5.15sec 1592036 1044257 Direct 109.7 0 824704 824704 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.80 109.65 0.00 0.00 1.5246 0.0000 90430610.50 90430610.50 0.00 1044257.49 1044257.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 109.65 100.00% 824704.13 527014 1209016 824965.89 773528 882274 90430611 90430611 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 109972 11.2% 47.9 6.26sec 689003 658908 Direct 95.9 205479 462216 344658 54.2%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.95 95.85 0.00 0.00 1.0457 0.0000 33035678.74 33035678.74 0.00 658908.17 658908.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.89 45.79% 205479.28 132571 304138 205597.47 183736 232215 9018322 9018322 0.00
crit 51.96 54.21% 462215.63 265183 695590 462359.92 419604 512394 24017357 24017357 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 13653 1.4% 32.3 5.10sec 124778 0 Direct 32.3 108989 218113 124781 14.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.33 32.33 0.00 0.00 0.0000 0.0000 4034076.29 4034076.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.65 85.53% 108989.45 87788 115880 108985.96 104154 112909 3013773 3013773 0.00
crit 4.68 14.47% 218113.36 175576 231761 216634.75 0 231761 1020303 1020303 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 249313 25.5% 19.7 15.50sec 3796605 3572856 Direct 38.4 140750 281521 205903 46.3%  
Periodic 293.4 156097 312170 228401 46.3% 196.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.73 38.38 293.40 293.40 1.0626 2.0179 74915643.19 74915643.19 0.00 122206.31 3572855.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.62 53.72% 140750.43 91975 211004 140744.32 121677 162618 2901913 2901913 0.00
crit 17.76 46.28% 281520.92 183974 422008 281489.24 240411 333574 5001039 5001039 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 157.5 53.67% 156097.32 47 435989 156298.56 136977 179151 24581304 24581304 0.00
crit 135.9 46.33% 312170.35 191 871967 312613.04 264291 366612 42431387 42431387 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 128452 13.2% 75.4 3.79sec 513441 418358 Direct 145.5 232535 464965 265894 14.4%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.37 145.54 0.00 0.00 1.2273 0.0000 38699340.92 38699340.92 0.00 418357.68 418357.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 124.65 85.65% 232534.53 148707 341090 232478.84 218677 247607 28986640 28986640 0.00
crit 20.89 14.35% 464965.48 297387 682136 464727.32 390135 552912 9712700 9712700 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9578 1.0% 19.7 15.14sec 146320 0 Direct 19.7 127859 255787 146322 14.4%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.69 19.69 0.00 0.00 0.0000 0.0000 2881256.87 2881256.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.85 85.57% 127858.99 112531 148541 127861.76 120034 139258 2154424 2154424 0.00
crit 2.84 14.43% 255787.10 225063 297083 241052.41 0 297083 726833 726833 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 41607 / 41607
Firebolt 41607 4.3% 107.4 2.80sec 116439 92169 Direct 106.6 102643 205407 117330 14.3%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.43 106.62 0.00 0.00 1.2633 0.0000 12509277.83 12509277.83 0.00 92169.07 92169.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.38 85.71% 102642.71 66395 119511 102646.14 100669 105046 9379293 9379293 0.00
crit 15.24 14.29% 205407.50 132790 239021 205393.25 182586 229062 3129984 3129984 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 119351 / 38036
Firebolt 119351 3.9% 48.1 5.63sec 237162 199511 Direct 47.8 208472 416965 238433 14.4%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.07 47.82 0.00 0.00 1.1887 0.0000 11401051.50 11401051.50 0.00 199510.92 199510.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.95 85.63% 208471.65 132790 239021 208621.21 203021 216085 8535923 8535923 0.00
crit 6.87 14.37% 416965.40 265579 478043 416918.22 0 478043 2865129 2865129 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 106250 / 8991
Immolation 81806 0.7% 1.0 0.00sec 2045236 0 Periodic 44.0 40659 81326 46497 14.4% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 21.99 43.99 0.0000 1.1166 2045236.14 2045236.14 0.00 83285.26 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.7 85.65% 40658.59 35166 42199 40658.58 39931 41579 1531784 1531784 0.00
crit 6.3 14.35% 81325.85 70332 84399 81229.86 0 84399 513452 513452 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24444 0.2% 22.0 1.12sec 27786 24886 Direct 22.0 24314 48638 27787 14.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.99 21.99 0.00 0.00 1.1166 0.0000 611130.85 898420.23 31.98 24886.22 24886.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.85 85.72% 24313.54 21029 25235 24313.74 23324 25235 458403 673896 31.98
crit 3.14 14.28% 48638.12 42059 50471 46934.68 0 50471 152728 224524 30.85
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 90373 / 7649
Doom Bolt 90373 0.8% 10.3 2.28sec 219906 96510 Direct 10.3 192080 384072 219926 14.5%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.27 10.27 0.00 0.00 2.2786 0.0000 2259387.39 2259387.39 0.00 96509.65 96509.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.78 85.50% 192079.84 185678 222814 192116.43 185678 222814 1687263 1687263 0.00
crit 1.49 14.50% 384072.09 371356 445628 307218.71 0 445628 572124 572124 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 106285 / 8993
Immolation 81830 0.7% 1.0 0.00sec 2045843 0 Periodic 44.0 40657 81349 46510 14.4% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 21.99 43.99 0.0000 1.1166 2045843.17 2045843.17 0.00 83309.98 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.7 85.62% 40656.62 35166 42199 40656.74 39931 41760 1531177 1531177 0.00
crit 6.3 14.38% 81349.26 70332 84399 81316.29 0 84399 514666 514666 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24454 0.2% 22.0 1.12sec 27798 24896 Direct 22.0 24315 48616 27798 14.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.99 21.99 0.00 0.00 1.1166 0.0000 611377.76 898783.21 31.98 24896.27 24896.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.84 85.67% 24315.41 21029 25235 24315.60 23618 25235 458156 673533 31.98
crit 3.15 14.33% 48615.66 42059 50471 46962.70 0 50471 153221 225250 30.89
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 106301 / 8995
Immolation 81830 0.7% 1.0 0.00sec 2045823 0 Periodic 44.0 40660 81310 46509 14.4% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 21.99 43.99 0.0000 1.1166 2045823.47 2045823.47 0.00 83309.18 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.7 85.61% 40659.94 35166 42199 40660.03 39855 41613 1531197 1531197 0.00
crit 6.3 14.39% 81309.75 70332 84399 81256.45 0 84399 514627 514627 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24471 0.2% 22.0 1.12sec 27817 24914 Direct 22.0 24310 48677 27817 14.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.99 21.99 0.00 0.00 1.1166 0.0000 611803.43 899409.00 31.98 24913.61 24913.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.83 85.61% 24310.27 21029 25235 24310.05 23733 25235 457731 672908 31.98
crit 3.17 14.39% 48676.86 42059 50471 47025.37 0 50471 154073 226501 30.89
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 106224 / 8990
Immolation 81798 0.7% 1.0 0.00sec 2045034 0 Periodic 44.0 40659 81320 46492 14.3% 8.2%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 21.99 43.99 0.0000 1.1166 2045033.56 2045033.56 0.00 83277.01 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.7 85.66% 40659.10 35166 42199 40659.13 39939 41596 1531987 1531987 0.00
crit 6.3 14.34% 81319.68 70332 84399 81231.97 0 84399 513047 513047 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24426 0.2% 22.0 1.12sec 27766 24868 Direct 22.0 24316 48613 27766 14.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.99 21.99 0.00 0.00 1.1166 0.0000 610676.57 897752.40 31.98 24867.72 24867.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.87 85.80% 24315.62 21029 25235 24315.81 23733 25235 458858 674564 31.98
crit 3.12 14.20% 48612.98 42059 50471 47091.94 0 50471 151819 223188 30.97
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 112410 / 18801
Shadow Bolt 112410 1.9% 4.3 60.17sec 1304827 0 Periodic 45.5 108332 216645 123820 14.3% 19.5%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 0.00 45.76 45.49 0.0000 1.2819 5633067.81 5633067.81 0.00 96030.75 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.0 85.70% 108331.99 70 129845 108145.79 0 129845 4223630 4223630 0.00
crit 6.5 14.30% 216644.78 416 259690 212942.45 0 259690 1409438 1409438 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 137006 / 9427
Chaos Bolt 137006 1.0% 4.3 58.73sec 650086 309695 Direct 4.3 0 654579 654579 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.34 4.31 0.00 0.00 2.0993 0.0000 2824111.00 2824111.00 0.00 309695.25 309695.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.31 100.00% 654578.96 618682 742418 654662.19 0 742418 2824111 2824111 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 227450 / 16975
Chaos Barrage 227450 1.7% 4.3 60.30sec 1170103 0 Periodic 141.7 31315 62663 35830 14.4% 7.8%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.34 0.00 142.43 141.75 0.0000 0.1654 5078820.73 5078820.73 0.00 215560.49 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.3 85.60% 31314.56 153 35708 31243.48 0 35708 3799428 3799428 0.00
crit 20.4 14.40% 62662.98 305 71417 62502.12 0 71417 1279393 1279393 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Portal_Pants
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Portal_Pants
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.61sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 12.9 23.66sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.93 0.00 0.00 0.00 1.0116 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Portal_Pants
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Portal_Pants
  • harmful:false
  • if_expr:
 
Havoc 15.0 20.69sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.04 0.00 0.00 0.00 1.0717 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.1 20.75sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.06 0.00 0.00 0.00 1.0086 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.93sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 0.9817 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.17sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0894 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7612 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.49% 78.49% 1.4(1.4) 19.3

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.80%
  • accelerando_2:24.60%
  • accelerando_3:14.69%
  • accelerando_4:6.52%
  • accelerando_5:2.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.6sec 180.6sec 6.84% 7.31% 0.0(0.0) 2.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.69% 0.0(0.0) 1.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.0 0.0 12.4sec 12.4sec 49.17% 46.58% 0.0(0.0) 1.1

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.17%

Trigger Attempt Success

  • trigger_pct:49.98%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.8sec 69.8sec 8.74% 8.74% 0.0(0.0) 3.2

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.74%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.3 31.5 11.7sec 5.1sec 58.49% 66.65% 31.5(31.5) 25.7

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:58.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 9.6 5.5 32.3sec 20.7sec 96.78% 95.00% 53.1(53.1) 8.6

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:96.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.88% 97.88% 0.0(0.0) 0.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.1sec 69.3sec 13.61% 13.61% 0.0(0.0) 3.3

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.61%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 128.0sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 121.2sec 121.2sec 17.74% 17.74% 0.0(0.0) 2.7

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.3 60.2sec
chaos_tear 4.3 59.4sec
chaos_portal 4.3 59.8sec
dimension_ripper 3.8 56.0sec

Resources

Resource Usage Type Count Total Average RPE APR
Portal_Pants
chaos_bolt Soul Shard 57.8 115.6 2.0 2.0 782250.6
havoc Mana 15.0 1323879.6 88000.0 87999.9 0.0
immolate Mana 19.7 1302330.5 66000.0 66000.0 57.5
incinerate Mana 75.4 4974637.0 66000.0 66000.7 7.8
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 107.4 4297.3 40.0 40.0 2911.0
pet - service_imp
firebolt Energy 48.1 1922.9 40.0 40.0 5928.9
pet - doomguard
doom_bolt Energy 10.3 359.6 35.0 35.0 6283.0
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.06 3633289.60 (48.61%) 241246.57 1336669.42 26.89%
immolate Soul Shard 64.31 63.53 (52.91%) 0.99 0.78 1.21%
conflagrate Soul Shard 47.95 47.87 (39.86%) 1.00 0.08 0.16%
mp5_regen Mana 475.54 3841656.76 (51.39%) 8078.51 729775.71 15.96%
soulsnatcher Soul Shard 8.68 8.68 (7.23%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1865.52 4131.31 (100.00%) 2.21 22.81 0.55%
pet - service_imp
energy_regen Energy 418.19 1310.45 (100.00%) 3.13 63.82 4.64%
pet - doomguard
energy_regen Energy 10.27 324.50 (100.00%) 31.58 44.83 12.14%
Resource RPS-Gain RPS-Loss
Health 0.00 16105.23
Mana 24824.07 25242.25
Soul Shard 0.40 0.40
Combat End Resource Mean Min Max
Mana 974606.90 432910.83 1100000.00
Soul Shard 1.84 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 14.8%

Statistics & Data Analysis

Fight Length
Sample Data Portal_Pants Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Portal_Pants Damage Per Second
Count 9999
Mean 979769.22
Minimum 866982.82
Maximum 1129738.29
Spread ( max - min ) 262755.48
Range [ ( max - min ) / 2 * 100% ] 13.41%
Standard Deviation 32742.2178
5th Percentile 928108.97
95th Percentile 1035610.50
( 95th Percentile - 5th Percentile ) 107501.53
Mean Distribution
Standard Deviation 327.4386
95.00% Confidence Intervall ( 979127.45 - 980410.99 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4291
0.1 Scale Factor Error with Delta=300 9151660
0.05 Scale Factor Error with Delta=300 36606639
0.01 Scale Factor Error with Delta=300 915165953
Priority Target DPS
Sample Data Portal_Pants Priority Target Damage Per Second
Count 9999
Mean 564937.82
Minimum 506726.35
Maximum 647624.70
Spread ( max - min ) 140898.35
Range [ ( max - min ) / 2 * 100% ] 12.47%
Standard Deviation 19526.9491
5th Percentile 534119.62
95th Percentile 597784.92
( 95th Percentile - 5th Percentile ) 63665.30
Mean Distribution
Standard Deviation 195.2793
95.00% Confidence Intervall ( 564555.08 - 565320.56 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4590
0.1 Scale Factor Error with Delta=300 3255011
0.05 Scale Factor Error with Delta=300 13020044
0.01 Scale Factor Error with Delta=300 325501098
DPS(e)
Sample Data Portal_Pants Damage Per Second (Effective)
Count 9999
Mean 979769.22
Minimum 866982.82
Maximum 1129738.29
Spread ( max - min ) 262755.48
Range [ ( max - min ) / 2 * 100% ] 13.41%
Damage
Sample Data Portal_Pants Damage
Count 9999
Mean 243996606.50
Minimum 173309211.28
Maximum 318994833.74
Spread ( max - min ) 145685622.46
Range [ ( max - min ) / 2 * 100% ] 29.85%
DTPS
Sample Data Portal_Pants Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Portal_Pants Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Portal_Pants Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Portal_Pants Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Portal_Pants Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Portal_Pants Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Portal_PantsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Portal_Pants Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 15.04 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.14 immolate,if=remains<=tick_time
F 0.53 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.10 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.80 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.15 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
L 14.06 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
M 3.67 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.89 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 11.93 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 57.12 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 75.68 incinerate
0.00 life_tap

Sample Sequence

01269ABCDEGHJKMKNPQQRKRRKRSSSKLCRRSSESSSSSQGJRKKRKCLRSSKQRRSSESSQCLRSSGJRKRKRSSKRSRSCKLRSESRQSSSQGJKCKLMRKRRSSKRSSRECFLRPISSSSSSGJRKKQRRKCLSSKRSSSERSSSCLSGJKQRRKKRSQKHRCLRSESSSSMSGJKKRRCKLRRSKSSRSERRSCLQRGJKOKRSKRSSCKLPQRRSESRRRSSSQSRCGJLQJJRJRRSJSMCSJELRSJ

Sample Sequence Table

time name target resources buffs
Pre flask Portal_Pants 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Portal_Pants 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Portal_Pants 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.123 dimensional_rift Fluffy_Pillow 1032868.4/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.015 immolate Fluffy_Pillow 1049444.3/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.906 immolate Fluffy_Pillow 1000001.5/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.797 berserking Fluffy_Pillow 950558.7/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.797 conflagrate Fluffy_Pillow 950558.7/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:04.573 conflagrate Fluffy_Pillow 967142.0/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, accelerando, potion_of_deadly_grace
0:05.337 service_imp Fluffy_Pillow 983715.0/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:06.103 conflagrate Fluffy_Pillow 1000331.5/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:06.869 summon_infernal Fluffy_Pillow 1016947.9/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:07.634 soul_harvest Fluffy_Pillow 1033542.7/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:07.634 dimensional_rift Fluffy_Pillow 1033542.7/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:08.398 dimensional_rift Fluffy_Pillow 1050115.7/1100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:09.163 chaos_bolt Fluffy_Pillow 1066710.5/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(2), potion_of_deadly_grace
0:10.688 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:11.442 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:12.333 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:13.276 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:14.090 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:15.160 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:16.214 incinerate Fluffy_Pillow 1034094.3/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:17.268 incinerate Fluffy_Pillow 987976.0/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:18.323 conflagrate Fluffy_Pillow 941876.5/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:19.196 life_tap Fluffy_Pillow 958376.9/1100000: 87% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:20.062 havoc enemy2 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:20.927 chaos_bolt Fluffy_Pillow 1028558.6/1100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, accelerando(3), potion_of_deadly_grace
0:22.654 chaos_bolt Fluffy_Pillow 1061618.5/1100000: 97% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:23.691 incinerate Fluffy_Pillow 1081469.7/1100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:24.727 incinerate Fluffy_Pillow 1034038.3/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:25.766 immolate Fluffy_Pillow 987513.6/1100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:26.672 incinerate Fluffy_Pillow 938097.4/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:27.742 incinerate Fluffy_Pillow 891981.0/1100000: 81% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando, potion_of_deadly_grace
0:28.810 incinerate Fluffy_Pillow 845827.4/1100000: 77% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando
0:29.881 incinerate Fluffy_Pillow 799729.5/1100000: 73% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando
0:30.950 incinerate Fluffy_Pillow 753594.4/1100000: 69% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando
0:32.018 dimensional_rift Fluffy_Pillow 707441.7/1100000: 64% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando(2)
0:32.895 immolate Fluffy_Pillow 723984.6/1100000: 66% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando(2)
0:33.775 conflagrate Fluffy_Pillow 674584.0/1100000: 61% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando(2)
0:34.653 chaos_bolt Fluffy_Pillow 691145.8/1100000: 63% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando(2)
0:36.405 conflagrate Fluffy_Pillow 724302.7/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
0:37.270 conflagrate Fluffy_Pillow 740861.3/1100000: 67% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
0:38.134 chaos_bolt Fluffy_Pillow 757400.8/1100000: 69% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:39.169 conflagrate Fluffy_Pillow 776792.0/1100000: 71% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:40.073 havoc enemy2 793337.8/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:40.979 life_tap Fluffy_Pillow 721920.2/1100000: 66% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:42.150 chaos_bolt Fluffy_Pillow 1068406.9/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:43.560 incinerate Fluffy_Pillow 1088259.5/1100000: 99% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:44.950 incinerate Fluffy_Pillow 1034071.5/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:46.340 conflagrate Fluffy_Pillow 987940.7/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:47.499 dimensional_rift Fluffy_Pillow 1004508.0/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:48.658 chaos_bolt Fluffy_Pillow 1021075.2/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
0:50.970 chaos_bolt Fluffy_Pillow 1054123.9/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:52.359 incinerate Fluffy_Pillow 1073978.9/1100000: 98% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:53.749 incinerate Fluffy_Pillow 1027848.1/1100000: 93% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:55.138 immolate Fluffy_Pillow 981704.0/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:56.302 incinerate Fluffy_Pillow 932271.7/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:57.714 incinerate Fluffy_Pillow 886268.8/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
0:59.101 dimensional_rift Fluffy_Pillow 840095.6/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:00.242 havoc enemy2 856651.5/1100000: 78% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:01.384 life_tap Fluffy_Pillow 785222.0/1100000: 71% mana | 3.0/5: 60% soul_shard lord_of_flames, nefarious_pact, accelerando(2)
1:02.137 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
1:03.634 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:04.520 incinerate Fluffy_Pillow 1034044.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:05.406 immolate Fluffy_Pillow 981090.8/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:06.161 conflagrate Fluffy_Pillow 926208.4/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:06.916 chaos_bolt Fluffy_Pillow 937326.1/1100000: 85% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:07.802 conflagrate Fluffy_Pillow 950372.7/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
1:08.558 chaos_bolt Fluffy_Pillow 961505.1/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:09.446 conflagrate Fluffy_Pillow 974406.3/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:10.208 chaos_bolt Fluffy_Pillow 985298.6/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:11.123 incinerate Fluffy_Pillow 998378.0/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:12.038 incinerate Fluffy_Pillow 945457.4/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:12.951 conflagrate Fluffy_Pillow 892508.9/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
1:14.356 chaos_bolt Fluffy_Pillow 912895.5/1100000: 83% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:15.966 incinerate Fluffy_Pillow 936256.6/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:17.577 chaos_bolt Fluffy_Pillow 893632.3/1100000: 81% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:19.190 incinerate Fluffy_Pillow 917038.2/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
1:20.778 havoc enemy2 874422.1/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:21.924 conflagrate Fluffy_Pillow 802985.2/1100000: 73% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:23.099 life_tap Fluffy_Pillow 819528.1/1100000: 75% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:24.274 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
1:26.621 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:28.010 immolate Fluffy_Pillow 1034058.0/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:29.152 incinerate Fluffy_Pillow 984628.5/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:30.521 chaos_bolt Fluffy_Pillow 938492.7/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:31.891 dimensional_rift Fluffy_Pillow 958371.5/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:33.032 incinerate Fluffy_Pillow 974927.4/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:34.402 incinerate Fluffy_Pillow 928806.1/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:35.770 incinerate Fluffy_Pillow 882655.8/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:37.139 dimensional_rift Fluffy_Pillow 836686.9/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:38.264 immolate Fluffy_Pillow 853252.9/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:39.433 conflagrate Fluffy_Pillow 803783.8/1100000: 73% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames
1:40.608 conflagrate Fluffy_Pillow 820326.8/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:41.783 havoc enemy2 836869.7/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:42.940 conflagrate Fluffy_Pillow 765408.4/1100000: 70% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:44.083 life_tap Fluffy_Pillow 781993.3/1100000: 71% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
1:45.224 service_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:46.353 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:48.599 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
1:49.708 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
1:51.036 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
1:52.346 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
1:53.657 incinerate Fluffy_Pillow 1034075.8/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
1:54.966 conflagrate Fluffy_Pillow 986641.1/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:56.142 chaos_bolt Fluffy_Pillow 1003198.1/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:57.553 incinerate Fluffy_Pillow 1023231.3/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:58.943 incinerate Fluffy_Pillow 977101.6/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:00.311 chaos_bolt Fluffy_Pillow 930952.2/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:01.662 immolate Fluffy_Pillow 950846.1/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:02.787 havoc enemy2 901413.2/1100000: 82% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:03.895 immolate enemy2 829967.7/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
2:05.004 life_tap Fluffy_Pillow 780539.8/1100000: 71% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
2:06.096 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(5)
2:08.278 soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
2:08.278 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5)
2:08.278 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(5), potion_of_deadly_grace
2:09.141 incinerate Fluffy_Pillow 1034070.4/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:10.068 incinerate Fluffy_Pillow 981121.7/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:10.997 incinerate Fluffy_Pillow 928201.2/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:11.925 incinerate Fluffy_Pillow 875336.2/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
2:12.840 incinerate Fluffy_Pillow 822416.7/1100000: 75% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:13.743 immolate Fluffy_Pillow 769519.2/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:14.497 conflagrate Fluffy_Pillow 714459.8/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:15.252 chaos_bolt Fluffy_Pillow 725414.9/1100000: 66% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:16.751 conflagrate Fluffy_Pillow 747446.8/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:17.505 conflagrate Fluffy_Pillow 758549.7/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:18.259 dimensional_rift Fluffy_Pillow 769652.6/1100000: 70% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:19.013 chaos_bolt Fluffy_Pillow 780755.5/1100000: 71% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:19.899 chaos_bolt Fluffy_Pillow 793802.2/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(3), potion_of_deadly_grace
2:21.487 conflagrate Fluffy_Pillow 817388.9/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(4), potion_of_deadly_grace
2:22.793 havoc enemy2 836901.7/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(4), potion_of_deadly_grace
2:24.128 life_tap Fluffy_Pillow 768394.6/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, potion_of_deadly_grace
2:25.511 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, devils_due, potion_of_deadly_grace
2:27.173 incinerate Fluffy_Pillow 1034070.4/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, devils_due, potion_of_deadly_grace
2:28.835 conflagrate Fluffy_Pillow 991674.4/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando, potion_of_deadly_grace
2:29.993 chaos_bolt Fluffy_Pillow 1008227.4/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando, potion_of_deadly_grace
2:32.305 incinerate Fluffy_Pillow 1041277.0/1100000: 95% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:33.672 incinerate Fluffy_Pillow 995112.2/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:35.040 incinerate Fluffy_Pillow 948961.9/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:36.407 immolate Fluffy_Pillow 903005.5/1100000: 82% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3), potion_of_deadly_grace
2:37.532 chaos_bolt Fluffy_Pillow 853668.1/1100000: 78% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(4), potion_of_deadly_grace
2:39.745 incinerate Fluffy_Pillow 886732.4/1100000: 81% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
2:41.074 incinerate Fluffy_Pillow 839564.2/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:42.485 incinerate Fluffy_Pillow 793477.4/1100000: 72% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:43.874 havoc enemy2 747332.4/1100000: 68% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:45.032 life_tap Fluffy_Pillow 675885.3/1100000: 61% mana | 0.0/5: 0% soul_shard lord_of_flames, accelerando
2:46.191 incinerate Fluffy_Pillow 1022452.5/1100000: 93% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:47.579 immolate Fluffy_Pillow 976293.2/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:48.738 conflagrate Fluffy_Pillow 926860.5/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando
2:49.897 conflagrate Fluffy_Pillow 943427.7/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:51.056 dimensional_rift Fluffy_Pillow 959994.9/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:52.197 chaos_bolt Fluffy_Pillow 976550.9/1100000: 89% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:54.474 chaos_bolt Fluffy_Pillow 1009598.5/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:55.883 conflagrate Fluffy_Pillow 1029436.0/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:57.058 conflagrate Fluffy_Pillow 1045979.0/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:58.216 chaos_bolt Fluffy_Pillow 1062531.9/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:59.605 incinerate Fluffy_Pillow 1082386.9/1100000: 98% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:00.994 dimensional_rift Fluffy_Pillow 1034057.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:02.283 conflagrate Fluffy_Pillow 1052482.7/1100000: 96% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:03.644 berserking Fluffy_Pillow 1072183.2/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:03.797 chaos_bolt Fluffy_Pillow 1074403.2/1100000: 98% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:05.778 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:06.771 life_tap Fluffy_Pillow 1028569.7/1100000: 94% mana | 1.0/5: 20% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:07.764 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:08.954 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:10.145 immolate Fluffy_Pillow 1034081.0/1100000: 94% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:11.168 incinerate Fluffy_Pillow 984644.3/1100000: 90% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:12.394 incinerate Fluffy_Pillow 938495.5/1100000: 85% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:13.604 incinerate Fluffy_Pillow 892386.2/1100000: 81% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:14.813 incinerate Fluffy_Pillow 844083.0/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:16.182 service_imp Fluffy_Pillow 798103.1/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:17.307 incinerate Fluffy_Pillow 814669.1/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:18.653 immolate Fluffy_Pillow 768489.4/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:19.778 conflagrate Fluffy_Pillow 719056.5/1100000: 65% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:20.887 conflagrate Fluffy_Pillow 735626.0/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:21.995 conflagrate Fluffy_Pillow 752180.6/1100000: 68% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
3:23.103 chaos_bolt Fluffy_Pillow 768735.1/1100000: 70% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:25.315 chaos_bolt Fluffy_Pillow 800987.3/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:26.725 havoc enemy2 820838.9/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:27.899 conflagrate Fluffy_Pillow 749367.7/1100000: 68% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:29.068 life_tap Fluffy_Pillow 765904.9/1100000: 70% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:30.210 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:31.579 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:32.948 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:34.316 conflagrate Fluffy_Pillow 1034058.0/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:35.459 incinerate Fluffy_Pillow 1050643.0/1100000: 96% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:36.828 incinerate Fluffy_Pillow 1004508.3/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:38.175 chaos_bolt Fluffy_Pillow 958343.3/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:40.421 incinerate Fluffy_Pillow 991416.4/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:41.769 immolate Fluffy_Pillow 944660.0/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:42.946 chaos_bolt Fluffy_Pillow 895231.2/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:44.356 chaos_bolt Fluffy_Pillow 915082.7/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:45.764 incinerate Fluffy_Pillow 934906.8/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:47.153 havoc enemy2 888761.7/1100000: 81% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:48.311 life_tap Fluffy_Pillow 817314.7/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:49.469 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:50.628 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:52.940 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:54.098 conflagrate Fluffy_Pillow 1034057.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:55.257 conflagrate Fluffy_Pillow 1050624.4/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:56.415 summon_doomguard Fluffy_Pillow 1067177.4/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:57.566 conflagrate Fluffy_Pillow 1083732.7/1100000: 99% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:58.735 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
4:01.083 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:02.473 conflagrate Fluffy_Pillow 1034071.5/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:03.632 chaos_bolt Fluffy_Pillow 1050638.7/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:05.019 incinerate Fluffy_Pillow 1070465.1/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:06.407 incinerate Fluffy_Pillow 1024305.7/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:07.796 havoc enemy2 978160.7/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:08.951 conflagrate Fluffy_Pillow 906739.8/1100000: 82% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:10.093 life_tap Fluffy_Pillow 923310.2/1100000: 84% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:11.234 soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:11.234 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:12.405 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos
4:14.752 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:15.681 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:16.608 immolate Fluffy_Pillow 1034042.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:17.383 incinerate Fluffy_Pillow 978953.6/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:18.312 chaos_bolt Fluffy_Pillow 926033.1/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
4:19.242 chaos_bolt Fluffy_Pillow 939171.4/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:20.155 chaos_bolt Fluffy_Pillow 952222.2/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:21.069 incinerate Fluffy_Pillow 965287.3/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:21.985 incinerate Fluffy_Pillow 912381.0/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:22.898 incinerate Fluffy_Pillow 859431.8/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:23.812 dimensional_rift Fluffy_Pillow 806497.0/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:24.575 incinerate Fluffy_Pillow 817403.6/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:25.489 chaos_bolt Fluffy_Pillow 764552.1/1100000: 70% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
4:28.173 havoc enemy2 803831.6/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
4:29.492 immolate Fluffy_Pillow 735304.6/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(4)
4:30.797 conflagrate Fluffy_Pillow 688803.4/1100000: 63% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, devils_due, accelerando(5)
4:32.164 life_tap Fluffy_Pillow 708304.8/1100000: 64% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
4:33.548 dimensional_rift Fluffy_Pillow 1057790.3/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:34.707 conflagrate Fluffy_Pillow 1074357.5/1100000: 98% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
4:35.867 conflagrate Fluffy_Pillow 1090939.1/1100000: 99% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:37.008 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:39.286 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:40.426 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:41.795 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:43.162 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:44.532 conflagrate Fluffy_Pillow 1034087.1/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:45.676 incinerate Fluffy_Pillow 1050631.4/1100000: 96% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:47.086 service_imp Fluffy_Pillow 1004703.0/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:48.244 havoc enemy2 1021255.9/1100000: 93% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:49.404 incinerate Fluffy_Pillow 949837.5/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:50.793 conflagrate Fluffy_Pillow 903716.6/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
4:52.173 immolate Fluffy_Pillow 923740.4/1100000: 84% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:53.313 life_tap Fluffy_Pillow 874281.8/1100000: 79% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:54.453 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:56.733 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:58.081 conflagrate Fluffy_Pillow 1034056.3/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 53667 53667 35024
Intellect 50744 49037 39379 (1221)
Spirit 1 1 0
Health 3220020 3220020 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50744 49037 0
Crit 14.36% 14.36% 3742
Haste 27.99% 26.99% 10122
Damage / Heal Versatility 6.62% 6.62% 3143
ManaReg per Second 14079 13969 0
Mastery 73.80% 73.80% 6641
Armor 1994 1994 1994
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Pillars of the Dark Portal
ilevel: 940, stats: { 314 Armor, +4726 Sta, +3150 Int, +1097 Crit, +822 Mastery }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Cloak of Azj'Aqir
ilevel: 900, stats: { 156 Armor, +1831 Sta, +1221 StrAgiInt, +584 Vers, +345 Haste }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Portal_Pants"
level=110
race=troll
role=spell
position=back
talents=2303021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=cloak_of_azjaqir,id=138373,bonus_id=3445,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=pillars_of_the_dark_portal,id=132357,ilevel=940
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.93
# gear_stamina=35024
# gear_intellect=39379
# gear_crit_rating=3742
# gear_haste_rating=10122
# gear_mastery_rating=6641
# gear_versatility_rating=3143
# gear_armor=1994
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Prydaz : 994253 dps, 573921 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
994252.7 994252.7 647.5 / 0.065% 128612.0 / 12.9% 32.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
25541.8 25541.8 Mana 0.00% 51.3 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Prydaz 994253
Chaos Bolt 305515 30.8% 58.0 5.05sec 1585217 1057646 Direct 111.2 0 826060 826060 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.96 111.22 0.00 0.00 1.4988 0.0000 91877715.92 91877715.92 0.00 1057646.09 1057646.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 111.22 100.00% 826059.64 518344 1223779 826406.06 762541 883337 91877716 91877716 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 112341 11.3% 48.5 6.19sec 695592 672787 Direct 97.0 204564 463616 347919 55.3%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.53 97.03 0.00 0.00 1.0339 0.0000 33759774.43 33759774.43 0.00 672786.91 672786.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.33 44.66% 204563.57 129237 305128 204626.03 181622 230189 8864135 8864135 0.00
crit 53.70 55.34% 463615.84 258482 704079 463724.82 409667 516129 24895640 24895640 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 13832 1.4% 32.7 5.03sec 124916 0 Direct 32.7 108312 216573 124915 15.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.71 32.71 0.00 0.00 0.0000 0.0000 4086136.99 4086136.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.69 84.66% 108311.57 87244 115162 108311.94 103400 112545 2999598 2999598 0.00
crit 5.02 15.34% 216572.90 174488 230324 215611.97 0 230324 1086539 1086539 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 254410 25.6% 19.9 15.28sec 3834734 3654176 Direct 38.8 140198 280444 206897 47.6%  
Periodic 297.8 155905 311993 229833 47.4% 196.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.94 38.77 297.77 297.77 1.0495 1.9889 76459969.18 76459969.18 0.00 124700.67 3654175.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.33 52.44% 140197.66 89659 211688 140152.09 119819 160024 2850573 2850573 0.00
crit 18.44 47.56% 280443.67 179353 423386 280342.44 230441 329567 5171501 5171501 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 156.7 52.64% 155904.75 73 437411 156085.60 134061 177587 24435129 24435129 0.00
crit 141.0 47.36% 311992.74 149 874826 312376.59 272581 368557 44002767 44002767 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 130381 13.2% 76.5 3.74sec 513150 424157 Direct 147.6 230574 461307 266105 15.4%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.53 147.58 0.00 0.00 1.2098 0.0000 39272298.50 39272298.50 0.00 424157.28 424157.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 124.86 84.60% 230573.84 144944 342202 230531.10 214216 247881 28788665 28788665 0.00
crit 22.73 15.40% 461306.77 289940 684390 461248.12 373737 542082 10483634 10483634 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9570 1.0% 20.0 14.96sec 143995 0 Direct 20.0 124769 249586 143997 15.4%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.99 19.99 0.00 0.00 0.0000 0.0000 2877846.38 2877846.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.91 84.60% 124768.98 109698 144802 124772.99 117011 135751 2109477 2109477 0.00
crit 3.08 15.40% 249586.03 219396 289603 237431.28 0 289603 768370 768370 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 41524 / 41524
Firebolt 41524 4.2% 108.9 2.76sec 114651 91979 Direct 108.1 100090 200212 115534 15.4%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.89 108.06 0.00 0.00 1.2465 0.0000 12484410.90 12484410.90 0.00 91979.07 91979.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.39 84.57% 100089.89 64723 116502 100094.74 97883 102294 9147065 9147065 0.00
crit 16.67 15.43% 200211.64 129446 233004 200218.17 177989 220059 3337346 3337346 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 120016 / 38238
Firebolt 120016 3.8% 49.2 5.53sec 233262 198397 Direct 48.9 203138 406242 234539 15.5%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.16 48.89 0.00 0.00 1.1757 0.0000 11466570.33 11466570.33 0.00 198397.30 198397.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.33 84.54% 203138.03 129446 233004 203288.64 197406 209703 8395908 8395908 0.00
crit 7.56 15.46% 406242.02 258893 466007 406373.46 0 466007 3070662 3070662 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 105050 / 8889
Immolation 80877 0.7% 1.0 0.00sec 2021999 0 Periodic 44.1 39761 79516 45865 15.4% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.04 44.09 0.0000 1.0997 2021998.72 2021998.72 0.00 83419.23 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.3 84.65% 39760.91 34281 41137 39761.29 38994 40581 1483789 1483789 0.00
crit 6.8 15.35% 79516.01 68561 82274 79439.47 0 82274 538210 538210 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24174 0.2% 22.0 1.10sec 27417 24934 Direct 22.0 23775 47570 27418 15.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.04 22.04 0.00 0.00 1.0997 0.0000 604368.74 888479.30 31.98 24933.73 24933.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.67 84.69% 23775.43 20500 24600 23775.58 23109 24600 443867 652526 31.98
crit 3.37 15.31% 47569.72 41000 49200 46431.34 0 49200 160502 235953 31.21
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 93731 / 7924
Doom Bolt 93731 0.8% 10.9 2.25sec 215814 95999 Direct 10.9 187168 374081 215835 15.3%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.86 10.86 0.00 0.00 2.2481 0.0000 2343346.96 2343346.96 0.00 95999.47 95999.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.19 84.67% 187168.26 181003 217204 187170.30 181003 217204 1720597 1720597 0.00
crit 1.66 15.33% 374080.66 362007 434408 311405.53 0 434408 622750 622750 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 105096 / 8894
Immolation 80918 0.7% 1.0 0.00sec 2023020 0 Periodic 44.1 39763 79493 45888 15.4% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.04 44.09 0.0000 1.0997 2023019.70 2023019.70 0.00 83461.35 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.3 84.58% 39762.99 34281 41137 39763.34 38994 40745 1482768 1482768 0.00
crit 6.8 15.42% 79493.24 68561 82274 79479.52 0 82274 540252 540252 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24179 0.2% 22.0 1.10sec 27423 24939 Direct 22.0 23774 47582 27423 15.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.04 22.04 0.00 0.00 1.0997 0.0000 604486.83 888652.90 31.98 24938.60 24938.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.67 84.67% 23774.31 20500 24600 23774.31 23023 24600 443749 652353 31.98
crit 3.38 15.33% 47582.04 41000 49200 46470.70 0 49200 160738 236300 31.23
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 105054 / 8890
Immolation 80860 0.7% 1.0 0.00sec 2021572 0 Periodic 44.1 39760 79531 45855 15.3% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.04 44.09 0.0000 1.0997 2021572.22 2021572.22 0.00 83401.63 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.3 84.67% 39759.55 34281 41137 39759.78 38851 40694 1484216 1484216 0.00
crit 6.8 15.33% 79531.12 68561 82274 79500.98 0 82274 537357 537357 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24194 0.2% 22.0 1.10sec 27441 24955 Direct 22.0 23778 47540 27441 15.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.04 22.04 0.00 0.00 1.0997 0.0000 604880.47 889231.59 31.98 24954.84 24954.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.65 84.59% 23778.16 20500 24600 23778.47 23136 24600 443355 651774 31.98
crit 3.40 15.41% 47539.65 41000 49200 46352.58 0 49200 161525 237458 31.18
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 105110 / 8896
Immolation 80918 0.7% 1.0 0.00sec 2023021 0 Periodic 44.1 39762 79505 45888 15.4% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.04 44.09 0.0000 1.0997 2023021.07 2023021.07 0.00 83461.41 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.3 84.59% 39761.88 34281 41137 39761.85 38913 40776 1482767 1482767 0.00
crit 6.8 15.41% 79505.46 68561 82274 79447.88 0 82274 540254 540254 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24193 0.2% 22.0 1.10sec 27439 24953 Direct 22.0 23779 47528 27439 15.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.04 22.04 0.00 0.00 1.0997 0.0000 604838.65 889170.10 31.98 24953.12 24953.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.65 84.59% 23779.22 20500 24600 23779.14 23109 24600 443397 651836 31.98
crit 3.40 15.41% 47527.96 41000 49200 46346.45 0 49200 161442 237335 31.18
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 112271 / 18908
Shadow Bolt 112271 1.9% 4.3 59.57sec 1304267 0 Periodic 46.0 106696 213498 123125 15.4% 19.6%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.34 0.00 46.22 45.97 0.0000 1.2769 5660054.03 5660054.03 0.00 95900.61 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.9 84.62% 106695.82 71 126576 106481.28 0 126576 4150359 4150359 0.00
crit 7.1 15.38% 213498.46 141 253152 210292.27 0 253152 1509695 1509695 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 134306 / 9265
Chaos Bolt 134306 0.9% 4.4 59.22sec 638436 308207 Direct 4.3 0 643139 643139 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 4.32 0.00 0.00 2.0715 0.0000 2780645.99 2780645.99 0.00 308207.27 308207.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.32 100.00% 643138.67 608484 730181 643256.85 0 730181 2780646 2780646 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 226653 / 17110
Chaos Barrage 226653 1.7% 4.4 59.22sec 1167727 0 Periodic 145.4 30502 61020 35204 15.4% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.38 0.00 146.04 145.37 0.0000 0.1632 5117561.34 5117561.34 0.00 214770.91 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 123.0 84.59% 30502.05 151 34809 30457.95 0 34809 3750922 3750922 0.00
crit 22.4 15.41% 61020.02 302 69619 60898.95 0 69619 1366639 1366639 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Prydaz
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Prydaz
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.70sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.0 23.43sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.01 0.00 0.00 0.00 1.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Prydaz
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Prydaz
  • harmful:false
  • if_expr:
 
Havoc 15.0 20.69sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.04 0.00 0.00 0.00 1.0611 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.2 20.54sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.18 0.00 0.00 0.00 0.9967 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.93sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 0.9703 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.04sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0800 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7552 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.53% 78.53% 1.4(1.4) 19.3

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.71%
  • accelerando_2:24.69%
  • accelerando_3:14.68%
  • accelerando_4:6.53%
  • accelerando_5:2.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.84% 7.44% 0.0(0.0) 2.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.63% 0.0(0.0) 1.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.3 0.0 12.3sec 12.3sec 49.19% 47.23% 0.0(0.0) 0.8

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.19%

Trigger Attempt Success

  • trigger_pct:49.98%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.8sec 69.8sec 8.71% 8.71% 0.0(0.0) 3.2

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.71%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.2 32.8 11.7sec 5.0sec 59.57% 67.40% 32.8(32.8) 25.6

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 8.4 6.8 36.7sec 20.5sec 97.47% 95.72% 51.2(51.2) 7.4

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:97.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.90% 97.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 70.1sec 69.5sec 13.54% 13.54% 0.0(0.0) 3.3

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.54%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 127.8sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 121.1sec 121.1sec 17.76% 17.76% 0.0(0.0) 2.7

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.3 59.7sec
chaos_tear 4.4 59.4sec
chaos_portal 4.3 59.2sec
dimension_ripper 3.9 54.9sec

Resources

Resource Usage Type Count Total Average RPE APR
Prydaz
chaos_bolt Soul Shard 59.0 117.9 2.0 2.0 779164.7
havoc Mana 15.0 1323941.2 88000.0 87999.9 0.0
immolate Mana 19.9 1315942.2 66000.0 65999.1 58.1
incinerate Mana 76.5 5051141.1 66000.0 66000.5 7.8
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 108.9 4355.6 40.0 40.0 2866.3
pet - service_imp
firebolt Energy 49.2 1966.4 40.0 40.0 5831.4
pet - doomguard
doom_bolt Energy 10.9 380.0 35.0 35.0 6166.1
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.18 3620426.16 (47.87%) 238571.30 1387471.47 27.71%
immolate Soul Shard 65.84 65.10 (53.19%) 0.99 0.75 1.13%
conflagrate Soul Shard 48.53 48.46 (39.60%) 1.00 0.07 0.15%
mp5_regen Mana 481.91 3942551.63 (52.13%) 8181.05 692932.44 14.95%
soulsnatcher Soul Shard 8.83 8.83 (7.21%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1868.41 4189.62 (100.00%) 2.24 22.82 0.54%
pet - service_imp
energy_regen Energy 424.25 1344.65 (100.00%) 3.17 63.84 4.53%
pet - doomguard
energy_regen Energy 10.86 344.95 (100.00%) 31.77 45.43 11.64%
Resource RPS-Gain RPS-Loss
Health 0.00 16009.29
Mana 25116.59 25541.82
Soul Shard 0.41 0.41
Combat End Resource Mean Min Max
Mana 968789.13 439873.66 1100000.00
Soul Shard 1.79 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 13.8%

Statistics & Data Analysis

Fight Length
Sample Data Prydaz Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Prydaz Damage Per Second
Count 9999
Mean 994252.71
Minimum 883817.39
Maximum 1127814.17
Spread ( max - min ) 243996.78
Range [ ( max - min ) / 2 * 100% ] 12.27%
Standard Deviation 33032.1902
5th Percentile 943216.88
95th Percentile 1052238.68
( 95th Percentile - 5th Percentile ) 109021.80
Mean Distribution
Standard Deviation 330.3384
95.00% Confidence Intervall ( 993605.26 - 994900.16 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4241
0.1 Scale Factor Error with Delta=300 9314476
0.05 Scale Factor Error with Delta=300 37257903
0.01 Scale Factor Error with Delta=300 931447563
Priority Target DPS
Sample Data Prydaz Priority Target Damage Per Second
Count 9999
Mean 573920.82
Minimum 505951.62
Maximum 646783.57
Spread ( max - min ) 140831.94
Range [ ( max - min ) / 2 * 100% ] 12.27%
Standard Deviation 19637.0907
5th Percentile 543383.49
95th Percentile 607990.32
( 95th Percentile - 5th Percentile ) 64606.83
Mean Distribution
Standard Deviation 196.3807
95.00% Confidence Intervall ( 573535.92 - 574305.72 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4498
0.1 Scale Factor Error with Delta=300 3291835
0.05 Scale Factor Error with Delta=300 13167338
0.01 Scale Factor Error with Delta=300 329183428
DPS(e)
Sample Data Prydaz Damage Per Second (Effective)
Count 9999
Mean 994252.71
Minimum 883817.39
Maximum 1127814.17
Spread ( max - min ) 243996.78
Range [ ( max - min ) / 2 * 100% ] 12.27%
Damage
Sample Data Prydaz Damage
Count 9999
Mean 248333741.41
Minimum 175531429.51
Maximum 326562791.95
Spread ( max - min ) 151031362.45
Range [ ( max - min ) / 2 * 100% ] 30.41%
DTPS
Sample Data Prydaz Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Prydaz Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Prydaz Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Prydaz Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Prydaz Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Prydaz Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data PrydazTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Prydaz Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 15.04 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.19 immolate,if=remains<=tick_time
F 0.55 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.24 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.86 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.68 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
L 14.18 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
M 3.67 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.89 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 12.01 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 58.28 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 76.85 incinerate
0.00 life_tap

Sample Sequence

01269ABCDEGHJKMNPQQRRKRKKRSQSKRLCSSSSERSSSRGJRKKRRKLCSSSKQRSSSRSSSSESSLCQGJRRKRKRKRSSKLCRRESSQRSSSGJKKCLMRKRRSKSRSSQESCLRPISSGJRKKQRKRSCLRKRSSRESSSSRRCGJLRRRJKRKRRKQHSCSLSERSSMSGJRKKRCKLRSSKRSSSSESSSSCQSLSSSGJRKOKRKRRRCKLPRSSESSQRSSRSSSSGJCLQRJJJRRRJRSSSCEJLMSJR

Sample Sequence Table

time name target resources buffs
Pre flask Prydaz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Prydaz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Prydaz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.109 dimensional_rift Fluffy_Pillow 1032898.0/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.990 immolate Fluffy_Pillow 1049499.5/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.868 immolate Fluffy_Pillow 1000044.5/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.748 berserking Fluffy_Pillow 950628.6/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:03.748 conflagrate Fluffy_Pillow 950628.6/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:04.504 conflagrate Fluffy_Pillow 967255.2/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:05.259 service_imp Fluffy_Pillow 983859.8/1100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:06.013 summon_infernal Fluffy_Pillow 1000442.5/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:06.757 soul_harvest Fluffy_Pillow 1017044.7/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
0:06.757 dimensional_rift Fluffy_Pillow 1017044.7/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
0:07.512 dimensional_rift Fluffy_Pillow 1033892.3/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
0:08.267 chaos_bolt Fluffy_Pillow 1050740.0/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
0:09.748 chaos_bolt Fluffy_Pillow 1083788.1/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:10.638 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
0:11.393 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5), potion_of_deadly_grace
0:12.258 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:13.036 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
0:13.821 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:14.892 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:15.947 dimensional_rift Fluffy_Pillow 1034094.2/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:16.828 incinerate Fluffy_Pillow 1050695.8/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:17.883 conflagrate Fluffy_Pillow 1004576.1/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:18.765 chaos_bolt Fluffy_Pillow 1021196.5/1100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:19.818 life_tap Fluffy_Pillow 1041039.2/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:20.696 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:21.574 incinerate Fluffy_Pillow 1028545.0/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:22.627 incinerate Fluffy_Pillow 982387.7/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:23.682 incinerate Fluffy_Pillow 936268.1/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:24.736 incinerate Fluffy_Pillow 890130.8/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:25.776 immolate Fluffy_Pillow 844020.0/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:26.641 chaos_bolt Fluffy_Pillow 794562.4/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:28.370 incinerate Fluffy_Pillow 826797.5/1100000: 75% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:29.439 incinerate Fluffy_Pillow 780642.5/1100000: 71% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:30.507 incinerate Fluffy_Pillow 734468.9/1100000: 67% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:31.576 chaos_bolt Fluffy_Pillow 688313.9/1100000: 63% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:32.646 immolate Fluffy_Pillow 708177.5/1100000: 64% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:33.539 conflagrate Fluffy_Pillow 658755.2/1100000: 60% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:34.433 chaos_bolt Fluffy_Pillow 675351.5/1100000: 61% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:35.503 conflagrate Fluffy_Pillow 695215.0/1100000: 63% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:36.390 conflagrate Fluffy_Pillow 711782.7/1100000: 65% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:37.270 chaos_bolt Fluffy_Pillow 728365.4/1100000: 66% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:38.325 chaos_bolt Fluffy_Pillow 748247.2/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:39.364 conflagrate Fluffy_Pillow 768117.3/1100000: 70% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:40.229 life_tap Fluffy_Pillow 784659.7/1100000: 71% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:41.124 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:42.251 incinerate Fluffy_Pillow 1028579.3/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:43.601 incinerate Fluffy_Pillow 982461.2/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
0:44.476 incinerate Fluffy_Pillow 929522.6/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
0:45.339 conflagrate Fluffy_Pillow 876590.0/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
0:46.095 dimensional_rift Fluffy_Pillow 888037.3/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
0:46.865 chaos_bolt Fluffy_Pillow 899696.5/1100000: 82% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
0:48.302 incinerate Fluffy_Pillow 921219.2/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:49.215 incinerate Fluffy_Pillow 868256.9/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:50.131 incinerate Fluffy_Pillow 815337.4/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:51.047 chaos_bolt Fluffy_Pillow 762418.0/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:51.961 incinerate Fluffy_Pillow 775469.9/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
0:52.876 incinerate Fluffy_Pillow 722658.3/1100000: 66% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:53.777 incinerate Fluffy_Pillow 669718.6/1100000: 61% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:54.679 incinerate Fluffy_Pillow 616793.4/1100000: 56% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:55.583 immolate Fluffy_Pillow 563897.2/1100000: 51% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
0:56.927 incinerate Fluffy_Pillow 517569.5/1100000: 47% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
0:58.493 incinerate Fluffy_Pillow 474944.7/1100000: 43% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4)
1:00.037 life_tap Fluffy_Pillow 432323.7/1100000: 39% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4)
1:01.325 havoc enemy2 781826.5/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4)
1:02.595 dimensional_rift Fluffy_Pillow 713330.1/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(5)
1:03.866 immolate Fluffy_Pillow 732849.0/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(5)
1:04.991 conflagrate Fluffy_Pillow 683391.3/1100000: 62% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:06.152 chaos_bolt Fluffy_Pillow 699970.4/1100000: 64% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames
1:08.466 chaos_bolt Fluffy_Pillow 733341.1/1100000: 67% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:09.836 conflagrate Fluffy_Pillow 753199.7/1100000: 68% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:10.980 chaos_bolt Fluffy_Pillow 769782.4/1100000: 70% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:12.348 conflagrate Fluffy_Pillow 789612.1/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:13.490 chaos_bolt Fluffy_Pillow 806165.8/1100000: 73% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:14.860 conflagrate Fluffy_Pillow 826024.4/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:16.002 chaos_bolt Fluffy_Pillow 842578.1/1100000: 77% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:17.373 incinerate Fluffy_Pillow 862452.5/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:18.723 incinerate Fluffy_Pillow 816312.3/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:20.072 conflagrate Fluffy_Pillow 769673.5/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:21.235 life_tap Fluffy_Pillow 786281.2/1100000: 71% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
1:22.395 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
1:23.536 chaos_bolt Fluffy_Pillow 1028539.2/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:25.814 chaos_bolt Fluffy_Pillow 1061701.1/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:27.164 immolate Fluffy_Pillow 1081561.9/1100000: 98% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:28.272 incinerate Fluffy_Pillow 1032100.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:29.601 incinerate Fluffy_Pillow 985937.3/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:30.932 dimensional_rift Fluffy_Pillow 939804.1/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:32.219 chaos_bolt Fluffy_Pillow 959014.2/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:34.434 incinerate Fluffy_Pillow 992050.7/1100000: 90% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:35.824 incinerate Fluffy_Pillow 945900.0/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:37.214 incinerate Fluffy_Pillow 899750.1/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:38.584 immolate Fluffy_Pillow 853608.8/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:39.726 conflagrate Fluffy_Pillow 804162.5/1100000: 73% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:40.868 conflagrate Fluffy_Pillow 820716.2/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:41.993 conflagrate Fluffy_Pillow 837266.0/1100000: 76% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
1:43.118 havoc enemy2 853815.8/1100000: 78% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(2)
1:44.224 life_tap Fluffy_Pillow 782356.4/1100000: 71% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(4)
1:45.319 service_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
1:46.412 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
1:48.596 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
1:49.716 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:51.106 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:52.498 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:53.867 conflagrate Fluffy_Pillow 1034058.0/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:55.010 incinerate Fluffy_Pillow 1050626.2/1100000: 96% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:56.378 chaos_bolt Fluffy_Pillow 1004455.8/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:57.747 incinerate Fluffy_Pillow 1024358.8/1100000: 93% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:59.095 incinerate Fluffy_Pillow 978189.2/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:00.445 dimensional_rift Fluffy_Pillow 932049.0/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:01.569 immolate Fluffy_Pillow 948584.1/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:02.695 incinerate Fluffy_Pillow 899300.2/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:04.025 havoc enemy2 853152.2/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:05.163 life_tap Fluffy_Pillow 781704.7/1100000: 71% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:06.322 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
2:08.637 soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:08.637 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:08.637 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:10.027 incinerate Fluffy_Pillow 1034057.1/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:11.417 immolate Fluffy_Pillow 987907.3/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:12.561 conflagrate Fluffy_Pillow 938489.9/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:13.706 chaos_bolt Fluffy_Pillow 955087.1/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:15.986 conflagrate Fluffy_Pillow 988136.6/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:17.129 conflagrate Fluffy_Pillow 1004704.8/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:18.273 dimensional_rift Fluffy_Pillow 1021287.4/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:19.416 chaos_bolt Fluffy_Pillow 1037855.6/1100000: 94% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:20.786 conflagrate Fluffy_Pillow 1057715.4/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:21.911 chaos_bolt Fluffy_Pillow 1074265.2/1100000: 98% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:23.259 incinerate Fluffy_Pillow 1094095.6/1100000: 99% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:24.609 havoc enemy2 1034071.4/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:25.768 life_tap Fluffy_Pillow 962622.0/1100000: 88% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:26.914 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:28.284 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:29.427 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:30.797 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:32.167 incinerate Fluffy_Pillow 1034072.5/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:33.536 chaos_bolt Fluffy_Pillow 987916.6/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:34.906 immolate Fluffy_Pillow 1007776.3/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:36.031 incinerate Fluffy_Pillow 958326.2/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:37.379 incinerate Fluffy_Pillow 912156.5/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:38.730 incinerate Fluffy_Pillow 865682.9/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:40.098 incinerate Fluffy_Pillow 819512.5/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:41.467 chaos_bolt Fluffy_Pillow 773356.7/1100000: 70% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:43.747 chaos_bolt Fluffy_Pillow 806406.1/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:45.116 havoc enemy2 826250.3/1100000: 75% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:46.259 immolate Fluffy_Pillow 754818.4/1100000: 69% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:47.400 conflagrate Fluffy_Pillow 705358.3/1100000: 64% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:48.528 life_tap Fluffy_Pillow 721952.3/1100000: 66% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:49.655 chaos_bolt Fluffy_Pillow 1068532.4/1100000: 97% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:51.870 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:53.260 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:54.629 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:55.773 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:56.915 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:58.286 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:59.413 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:00.760 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:02.108 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:03.231 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:04.340 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:04.340 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:05.498 havoc enemy2 1034082.1/1100000: 94% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos
3:06.509 incinerate Fluffy_Pillow 962684.8/1100000: 88% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames
3:07.718 life_tap Fluffy_Pillow 916539.1/1100000: 83% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames
3:08.727 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames
3:09.936 immolate Fluffy_Pillow 1034065.7/1100000: 94% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames
3:10.944 chaos_bolt Fluffy_Pillow 984619.1/1100000: 90% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames
3:12.958 incinerate Fluffy_Pillow 1017695.4/1100000: 93% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:14.149 incinerate Fluffy_Pillow 971549.9/1100000: 88% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:15.323 service_imp Fluffy_Pillow 923242.1/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:16.449 incinerate Fluffy_Pillow 939806.6/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:17.799 immolate Fluffy_Pillow 893666.4/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:18.925 conflagrate Fluffy_Pillow 844231.0/1100000: 77% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:20.048 chaos_bolt Fluffy_Pillow 860751.4/1100000: 78% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:22.296 conflagrate Fluffy_Pillow 893822.7/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:23.405 conflagrate Fluffy_Pillow 910375.9/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:24.513 chaos_bolt Fluffy_Pillow 926914.2/1100000: 84% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:25.844 havoc enemy2 946202.7/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:27.002 conflagrate Fluffy_Pillow 874739.0/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:28.162 life_tap Fluffy_Pillow 891303.9/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:29.322 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:30.712 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:32.085 incinerate Fluffy_Pillow 1034116.0/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:33.455 conflagrate Fluffy_Pillow 988071.4/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:34.593 chaos_bolt Fluffy_Pillow 1004812.5/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:35.942 incinerate Fluffy_Pillow 1024800.3/1100000: 93% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:37.274 incinerate Fluffy_Pillow 978682.1/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:38.605 incinerate Fluffy_Pillow 932549.0/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:39.937 incinerate Fluffy_Pillow 886481.4/1100000: 81% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:41.250 immolate Fluffy_Pillow 840362.7/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:42.344 incinerate Fluffy_Pillow 790927.9/1100000: 72% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
3:43.209 incinerate Fluffy_Pillow 737595.1/1100000: 67% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:44.111 incinerate Fluffy_Pillow 684669.9/1100000: 62% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:45.014 incinerate Fluffy_Pillow 631759.3/1100000: 57% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:45.916 havoc enemy2 578834.1/1100000: 53% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:46.671 dimensional_rift Fluffy_Pillow 501778.1/1100000: 46% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:47.426 incinerate Fluffy_Pillow 512722.1/1100000: 47% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:48.327 life_tap Fluffy_Pillow 459782.4/1100000: 42% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:49.082 incinerate Fluffy_Pillow 800726.4/1100000: 73% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:49.983 incinerate Fluffy_Pillow 747786.7/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:50.885 incinerate Fluffy_Pillow 694861.5/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:51.787 immolate Fluffy_Pillow 641936.3/1100000: 58% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:52.543 conflagrate Fluffy_Pillow 586894.8/1100000: 53% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
3:53.297 chaos_bolt Fluffy_Pillow 597824.3/1100000: 54% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando
3:54.798 conflagrate Fluffy_Pillow 619701.5/1100000: 56% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
3:56.152 summon_doomguard Fluffy_Pillow 639211.2/1100000: 58% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:57.517 conflagrate Fluffy_Pillow 658703.5/1100000: 60% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:58.882 chaos_bolt Fluffy_Pillow 678195.8/1100000: 62% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due
4:01.610 conflagrate Fluffy_Pillow 717582.6/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
4:02.956 chaos_bolt Fluffy_Pillow 737093.3/1100000: 67% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:04.326 chaos_bolt Fluffy_Pillow 756952.0/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:05.698 chaos_bolt Fluffy_Pillow 776839.6/1100000: 71% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:07.067 havoc enemy2 796684.6/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:08.192 conflagrate Fluffy_Pillow 725234.5/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:09.297 life_tap Fluffy_Pillow 741757.9/1100000: 67% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
4:10.391 soul_harvest Fluffy_Pillow 1088323.2/1100000: 99% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
4:10.391 chaos_bolt Fluffy_Pillow 1088323.2/1100000: 99% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4)
4:11.701 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos
4:13.092 incinerate Fluffy_Pillow 1034072.5/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:14.462 immolate Fluffy_Pillow 987931.1/1100000: 90% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:15.215 incinerate Fluffy_Pillow 932846.1/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:16.118 incinerate Fluffy_Pillow 879935.4/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando
4:17.021 dimensional_rift Fluffy_Pillow 827024.7/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando
4:17.774 chaos_bolt Fluffy_Pillow 837939.8/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando
4:19.274 incinerate Fluffy_Pillow 859682.8/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:20.176 incinerate Fluffy_Pillow 806757.6/1100000: 73% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:21.079 chaos_bolt Fluffy_Pillow 753846.9/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:21.981 incinerate Fluffy_Pillow 766921.7/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:22.884 incinerate Fluffy_Pillow 714011.0/1100000: 65% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:23.786 incinerate Fluffy_Pillow 661085.9/1100000: 60% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:24.689 incinerate Fluffy_Pillow 608175.2/1100000: 55% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:25.591 immolate Fluffy_Pillow 555142.5/1100000: 50% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando
4:26.936 conflagrate Fluffy_Pillow 508638.8/1100000: 46% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, devils_due, accelerando
4:28.280 havoc enemy2 528120.6/1100000: 48% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
4:29.607 life_tap Fluffy_Pillow 459642.0/1100000: 42% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
4:30.932 dimensional_rift Fluffy_Pillow 809134.0/1100000: 74% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
4:32.434 chaos_bolt Fluffy_Pillow 831229.9/1100000: 76% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
4:35.080 conflagrate Fluffy_Pillow 870155.1/1100000: 79% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:36.207 conflagrate Fluffy_Pillow 886734.3/1100000: 81% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:37.332 conflagrate Fluffy_Pillow 903284.2/1100000: 82% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:38.484 chaos_bolt Fluffy_Pillow 919844.2/1100000: 84% mana | 5.0/5: 100% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
4:39.873 chaos_bolt Fluffy_Pillow 939679.9/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:41.242 chaos_bolt Fluffy_Pillow 959524.0/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:42.612 conflagrate Fluffy_Pillow 979383.8/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:43.737 chaos_bolt Fluffy_Pillow 995933.6/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:45.086 incinerate Fluffy_Pillow 1015778.7/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:46.435 incinerate Fluffy_Pillow 969623.8/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:47.784 incinerate Fluffy_Pillow 923468.8/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
4:49.134 havoc enemy2 877328.6/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:50.260 immolate Fluffy_Pillow 805893.2/1100000: 73% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:51.385 conflagrate Fluffy_Pillow 756443.0/1100000: 69% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, accelerando(2)
4:52.528 life_tap Fluffy_Pillow 772974.1/1100000: 70% mana | 2.0/5: 40% soul_shard lord_of_flames
4:53.685 service_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:54.828 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:56.196 conflagrate Fluffy_Pillow 1034043.5/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
4:57.338 chaos_bolt Fluffy_Pillow 1050597.2/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52943 52943 34467
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3176580 3176580 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 15.38% 15.38% 4150
Haste 29.82% 28.82% 10807
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14280 14170 0
Mastery 78.87% 78.87% 7314
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Prydaz, Xavaric's Magnum Opus
ilevel: 940, stats: { +2658 Sta, +1495 Mastery, +1495 Crit, +1495 Haste }, gems: { +150 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Prydaz"
level=110
race=troll
role=spell
position=back
talents=2303021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=prydaz_xavarics_magnum_opus,id=132444,ilevel=940,gem_id=130220,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=907.27
# gear_stamina=34467
# gear_intellect=38456
# gear_crit_rating=4150
# gear_haste_rating=10807
# gear_mastery_rating=7314
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Sephuz : 966689 dps, 563067 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
966688.6 966688.6 627.2 / 0.065% 123261.8 / 12.8% 30.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
25583.7 25583.7 Mana 0.00% 51.8 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sephuz 966689
Chaos Bolt 296093 30.7% 59.8 4.89sec 1489980 1011184 Direct 114.9 0 775119 775119 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.76 114.88 0.00 0.00 1.4735 0.0000 89047886.75 89047886.75 0.00 1011183.89 1011183.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 114.88 100.00% 775118.76 541902 1075986 775436.31 734933 816389 89047887 89047887 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 106790 11.1% 48.9 6.14sec 656255 640278 Direct 97.8 184043 430704 328253 58.5%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.90 97.77 0.00 0.00 1.0250 0.0000 32093311.70 32093311.70 0.00 640278.34 640278.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.61 41.54% 184042.51 129233 256614 184093.65 165846 203687 7474040 7474040 0.00
crit 57.16 58.46% 430704.27 258501 619055 430744.14 392493 468906 24619271 24619271 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 14593 1.5% 33.0 5.02sec 130761 0 Direct 33.0 108406 216933 130760 20.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.97 32.97 0.00 0.00 0.0000 0.0000 4311058.41 4311058.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.18 79.40% 108405.62 87244 115162 108403.54 103256 112904 2837829 2837829 0.00
crit 6.79 20.60% 216933.07 174488 230324 216867.71 0 230324 1473230 1473230 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 239603 24.8% 20.1 15.14sec 3583670 3445764 Direct 39.0 125906 251832 192014 52.5%  
Periodic 301.0 140425 280825 214380 52.7% 196.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.09 38.96 301.00 301.00 1.0401 1.9676 72009575.29 72009575.29 0.00 117438.77 3445763.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.51 47.50% 125905.80 89665 178033 125851.07 107198 141395 2329954 2329954 0.00
crit 20.45 52.50% 251831.51 179329 356066 251776.32 219269 281395 5150746 5150746 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 142.5 47.33% 140425.01 74 397285 140586.90 123029 165994 20004277 20004277 0.00
crit 158.6 52.67% 280825.20 136 835341 281147.67 246538 321411 44524598 44524598 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 122216 12.7% 76.6 3.74sec 480801 401155 Direct 147.4 207000 414035 249677 20.6%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.56 147.43 0.00 0.00 1.1986 0.0000 36809558.71 36809558.71 0.00 401154.75 401154.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 117.04 79.39% 206999.79 144940 287792 206970.10 196754 218147 24227469 24227469 0.00
crit 30.39 20.61% 414035.21 289930 575584 413999.02 369448 468138 12582089 12582089 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 10087 1.0% 20.1 14.85sec 150571 0 Direct 20.1 124784 249597 150572 20.7%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.13 20.13 0.00 0.00 0.0000 0.0000 3031719.34 3031719.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.97 79.34% 124783.75 109698 144802 124788.57 118673 136757 1993395 1993395 0.00
crit 4.16 20.66% 249597.21 219396 289603 245870.29 0 289603 1038324 1038324 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 43843 / 43843
Firebolt 43843 4.5% 110.0 2.74sec 119875 97222 Direct 109.1 100145 200284 120804 20.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.97 109.12 0.00 0.00 1.2330 0.0000 13182505.62 13182505.62 0.00 97221.85 97221.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.61 79.37% 100145.45 64723 116502 100150.61 97851 102595 8673835 8673835 0.00
crit 22.51 20.63% 200284.10 129446 233004 200285.70 184461 216823 4508671 4508671 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 125793 / 40063
Firebolt 125793 4.1% 49.3 5.51sec 243864 209554 Direct 49.0 203294 406624 245188 20.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.26 49.00 0.00 0.00 1.1637 0.0000 12013947.81 12013947.81 0.00 209554.13 209554.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.90 79.40% 203294.08 129446 233004 203446.47 196380 212810 7909004 7909004 0.00
crit 10.10 20.60% 406624.45 258893 466007 406945.22 362450 466007 4104944 4104944 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 111376 / 9424
Immolation 85754 0.7% 1.0 0.00sec 2143923 0 Periodic 44.7 39765 79524 47993 20.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.34 44.67 0.0000 1.0883 2143923.26 2143923.26 0.00 88201.89 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.4 79.31% 39764.65 34281 41137 39766.55 38773 40929 1408782 1408782 0.00
crit 9.2 20.69% 79524.01 68561 82274 79512.86 0 82274 735142 735142 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25622 0.2% 22.3 1.09sec 28679 26354 Direct 22.3 23777 47571 28680 20.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.34 22.34 0.00 0.00 1.0883 0.0000 640581.82 941715.95 31.98 26353.80 26353.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.73 79.40% 23777.39 20500 24600 23778.19 22892 24600 421682 619913 31.98
crit 4.60 20.60% 47570.83 41000 49200 47240.71 0 49200 218900 321803 31.76
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 99422 / 8400
Doom Bolt 99422 0.9% 11.0 2.23sec 225944 101553 Direct 11.0 187093 374547 225950 20.7%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.00 11.00 0.00 0.00 2.2249 0.0000 2485611.65 2485611.65 0.00 101553.02 101553.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.72 79.27% 187092.94 181003 217204 187111.19 181003 217204 1631379 1631379 0.00
crit 2.28 20.73% 374547.42 362007 434408 346091.27 0 434408 854233 854233 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 111379 / 9425
Immolation 85770 0.7% 1.0 0.00sec 2144332 0 Periodic 44.7 39764 79530 48001 20.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.34 44.67 0.0000 1.0883 2144331.93 2144331.93 0.00 88218.70 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.4 79.29% 39763.88 34281 41137 39765.71 38773 40908 1408373 1408373 0.00
crit 9.3 20.71% 79529.88 68561 82274 79543.90 68561 82274 735959 735959 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25609 0.2% 22.3 1.09sec 28664 26340 Direct 22.3 23779 47558 28664 20.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.34 22.34 0.00 0.00 1.0883 0.0000 640243.54 941218.64 31.98 26339.88 26339.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.75 79.46% 23779.08 20500 24600 23780.25 22843 24600 422020 620410 31.98
crit 4.59 20.54% 47557.86 41000 49200 47211.70 0 49200 218223 320809 31.74
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 111320 / 9421
Immolation 85703 0.7% 1.0 0.00sec 2142655 0 Periodic 44.7 39763 79536 47964 20.6% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.34 44.67 0.0000 1.0883 2142655.43 2142655.43 0.00 88149.73 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.5 79.38% 39763.04 34281 41137 39765.07 38851 40756 1410049 1410049 0.00
crit 9.2 20.62% 79536.40 68561 82274 79535.28 0 82274 732606 732606 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25617 0.2% 22.3 1.09sec 28674 26349 Direct 22.3 23776 47584 28674 20.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.34 22.34 0.00 0.00 1.0883 0.0000 640458.40 941534.51 31.98 26348.72 26348.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.74 79.43% 23775.65 20500 24600 23776.58 22736 24600 421805 620094 31.98
crit 4.60 20.57% 47584.34 41000 49200 47274.47 0 49200 218653 321440 31.76
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 111366 / 9425
Immolation 85726 0.7% 1.0 0.00sec 2143236 0 Periodic 44.7 39766 79512 47977 20.7% 8.1%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.34 44.67 0.0000 1.0883 2143236.21 2143236.21 0.00 88173.62 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.4 79.34% 39766.17 34281 41137 39768.26 38773 40883 1409469 1409469 0.00
crit 9.2 20.66% 79512.26 68561 82274 79517.19 68561 82274 733767 733767 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 25640 0.2% 22.3 1.09sec 28699 26372 Direct 22.3 23781 47547 28699 20.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.34 22.34 0.00 0.00 1.0883 0.0000 641016.46 942354.92 31.98 26371.68 26371.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.71 79.31% 23780.54 20500 24600 23781.63 22736 24600 421247 619274 31.98
crit 4.62 20.69% 47546.67 41000 49200 47275.87 0 49200 219769 323081 31.80
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 118450 / 20030
Shadow Bolt 118450 2.1% 4.3 60.14sec 1378208 0 Periodic 46.2 107463 214803 129742 20.8% 19.6%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.35 0.00 46.43 46.18 0.0000 1.2736 5991240.94 5991240.94 0.00 101312.92 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.6 79.24% 107462.82 70 126576 107279.67 0 126576 3932431 3932431 0.00
crit 9.6 20.76% 214803.23 226 253152 213332.40 0 253152 2058810 2058810 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 140671 / 9718
Chaos Bolt 140671 1.0% 4.4 59.00sec 667888 325539 Direct 4.3 0 672337 672337 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 4.33 0.00 0.00 2.0517 0.0000 2913901.49 2913901.49 0.00 325539.21 325539.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.33 100.00% 672337.45 636146 763376 672448.72 0 763376 2913901 2913901 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 239154 / 17947
Chaos Barrage 239154 1.9% 4.4 59.86sec 1230065 0 Periodic 146.0 30515 61020 36791 20.6% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.37 0.00 146.77 146.05 0.0000 0.1617 5373261.25 5373261.25 0.00 226452.35 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 116.0 79.43% 30515.05 153 34809 30471.90 0 34809 3539803 3539803 0.00
crit 30.0 20.57% 61019.51 305 69619 60928.04 0 69619 1833459 1833459 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Sephuz
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sephuz
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.86sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.0 23.54sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 0.00 0.00 0.00 0.9931 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sephuz
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sephuz
  • harmful:false
  • if_expr:
 
Havoc 15.1 20.67sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.05 0.00 0.00 0.00 1.0536 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.3 20.42sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.27 0.00 0.00 0.00 0.9885 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 92.03sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 0.9607 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.97sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0667 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7535 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.50% 78.50% 1.4(1.4) 19.3

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.75%
  • accelerando_2:24.62%
  • accelerando_3:14.69%
  • accelerando_4:6.52%
  • accelerando_5:2.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.9sec 180.9sec 6.84% 7.43% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.62% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.5 0.0 12.2sec 12.2sec 49.26% 47.65% 0.0(0.0) 0.6

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.26%

Trigger Attempt Success

  • trigger_pct:50.01%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.4 0.0 70.2sec 70.2sec 8.65% 8.65% 0.0(0.0) 3.2

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.65%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.1 34.7 11.8sec 4.9sec 60.77% 68.71% 34.7(34.7) 25.4

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:60.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 7.1 8.2 43.6sec 20.4sec 98.03% 96.48% 49.0(49.0) 6.1

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:98.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.92% 97.92% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 70.6sec 69.7sec 13.46% 13.46% 0.0(0.0) 3.3

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.46%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 127.9sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 121.0sec 121.0sec 17.77% 17.77% 0.0(0.0) 2.7

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.3 59.5sec
chaos_tear 4.4 59.3sec
chaos_portal 4.3 59.6sec
dimension_ripper 3.8 55.1sec

Resources

Resource Usage Type Count Total Average RPE APR
Sephuz
chaos_bolt Soul Shard 60.8 121.5 2.0 2.0 732729.9
havoc Mana 15.1 1324530.6 88000.0 87999.9 0.0
immolate Mana 20.1 1326182.3 66000.0 65999.5 54.3
incinerate Mana 76.6 5052981.9 66000.0 66001.4 7.3
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 110.0 4398.7 40.0 40.0 2996.9
pet - service_imp
firebolt Energy 49.3 1970.6 40.0 40.0 6096.5
pet - doomguard
doom_bolt Energy 11.0 385.0 35.0 35.0 6455.5
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.27 3567291.98 (47.11%) 233637.06 1471319.44 29.20%
immolate Soul Shard 68.81 67.99 (53.98%) 0.99 0.82 1.19%
conflagrate Soul Shard 48.90 48.83 (38.77%) 1.00 0.08 0.16%
mp5_regen Mana 486.59 4005601.40 (52.89%) 8231.91 677658.64 14.47%
soulsnatcher Soul Shard 9.13 9.13 (7.25%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1872.03 4232.73 (100.00%) 2.26 22.82 0.54%
pet - service_imp
energy_regen Energy 429.59 1359.82 (100.00%) 3.17 63.77 4.48%
pet - doomguard
energy_regen Energy 11.00 349.95 (100.00%) 31.81 45.62 11.53%
Resource RPS-Gain RPS-Loss
Health 0.00 15998.90
Mana 25149.52 25583.66
Soul Shard 0.42 0.42
Combat End Resource Mean Min Max
Mana 968801.81 505412.86 1100000.00
Soul Shard 1.78 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 13.5%

Statistics & Data Analysis

Fight Length
Sample Data Sephuz Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Sephuz Damage Per Second
Count 9999
Mean 966688.62
Minimum 860494.60
Maximum 1127839.13
Spread ( max - min ) 267344.54
Range [ ( max - min ) / 2 * 100% ] 13.83%
Standard Deviation 31997.8881
5th Percentile 917760.53
95th Percentile 1022183.33
( 95th Percentile - 5th Percentile ) 104422.80
Mean Distribution
Standard Deviation 319.9949
95.00% Confidence Intervall ( 966061.45 - 967315.80 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4209
0.1 Scale Factor Error with Delta=300 8740300
0.05 Scale Factor Error with Delta=300 34961197
0.01 Scale Factor Error with Delta=300 874029917
Priority Target DPS
Sample Data Sephuz Priority Target Damage Per Second
Count 9999
Mean 563066.64
Minimum 506252.33
Maximum 660447.95
Spread ( max - min ) 154195.63
Range [ ( max - min ) / 2 * 100% ] 13.69%
Standard Deviation 19223.2464
5th Percentile 533114.03
95th Percentile 596662.91
( 95th Percentile - 5th Percentile ) 63548.88
Mean Distribution
Standard Deviation 192.2421
95.00% Confidence Intervall ( 562689.86 - 563443.43 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4478
0.1 Scale Factor Error with Delta=300 3154548
0.05 Scale Factor Error with Delta=300 12618192
0.01 Scale Factor Error with Delta=300 315454795
DPS(e)
Sample Data Sephuz Damage Per Second (Effective)
Count 9999
Mean 966688.62
Minimum 860494.60
Maximum 1127839.13
Spread ( max - min ) 267344.54
Range [ ( max - min ) / 2 * 100% ] 13.83%
Damage
Sample Data Sephuz Damage
Count 9999
Mean 237303110.20
Minimum 171902256.43
Maximum 312129093.24
Spread ( max - min ) 140226836.81
Range [ ( max - min ) / 2 * 100% ] 29.55%
DTPS
Sample Data Sephuz Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sephuz Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sephuz Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sephuz Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sephuz Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sephuz Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data SephuzTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Sephuz Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 15.05 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.22 immolate,if=remains<=tick_time
F 0.61 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.30 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.97 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.94 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
L 14.27 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
M 3.67 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.90 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 12.00 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 60.08 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 76.89 incinerate
0.00 life_tap

Sample Sequence

01269ABCDEGHJMKNPQQRKRKRSKSSSKRLCRSSESSSSSGJRRKRKKRLSCKRQRRRSSESRSLGCJRKRKRKRFRKRLSSCERSSSQSMGJKRKLCRRKRSKRSSSSESLRCSPISGJKRKRQKRSLSKCRSSERSQSSSSSSSSLGJRCKKRKRSSSSKRSQLRHSSEMSCSSSGJKRKRKLRRSSCKRSSESSSLRSQGJCKRKKORSSSKLRPSSCESRSSSSSSSRGJLRKRKCKQRJMRRSJELGRJRCSSSJR

Sample Sequence Table

time name target resources buffs
Pre flask Sephuz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Sephuz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Sephuz 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:00.755 dimensional_rift Fluffy_Pillow 1023058.3/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:01.391 immolate Fluffy_Pillow 1035168.2/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, nefarious_pact, accelerando, potion_of_deadly_grace
0:02.142 immolate Fluffy_Pillow 983518.8/1100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
0:02.895 berserking Fluffy_Pillow 932121.3/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:02.895 conflagrate Fluffy_Pillow 932121.3/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:03.651 service_imp Fluffy_Pillow 949162.3/1100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:04.403 conflagrate Fluffy_Pillow 966113.2/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:05.159 summon_infernal Fluffy_Pillow 983154.2/1100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:05.914 soul_harvest Fluffy_Pillow 1000172.7/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:05.914 dimensional_rift Fluffy_Pillow 1000172.7/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:06.670 dimensional_rift Fluffy_Pillow 1017213.7/1100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:07.422 chaos_bolt Fluffy_Pillow 1034164.6/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:08.388 conflagrate Fluffy_Pillow 1055939.2/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:09.144 chaos_bolt Fluffy_Pillow 1072980.3/1100000: 98% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:09.899 conflagrate Fluffy_Pillow 1089998.8/1100000: 99% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:10.653 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:11.409 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
0:12.170 conflagrate Fluffy_Pillow 1037987.8/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_deadly_grace
0:13.103 incinerate Fluffy_Pillow 1057531.9/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, potion_of_deadly_grace
0:14.350 incinerate Fluffy_Pillow 1014927.8/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
0:15.579 incinerate Fluffy_Pillow 972328.9/1100000: 88% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_deadly_grace
0:16.808 conflagrate Fluffy_Pillow 929729.9/1100000: 85% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_deadly_grace
0:17.834 chaos_bolt Fluffy_Pillow 949265.7/1100000: 86% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, devils_due, accelerando, potion_of_deadly_grace
0:19.881 life_tap Fluffy_Pillow 988599.8/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando(2), potion_of_deadly_grace
0:20.892 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:21.750 chaos_bolt Fluffy_Pillow 1028577.4/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:22.779 incinerate Fluffy_Pillow 1048586.1/1100000: 95% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:23.794 incinerate Fluffy_Pillow 1002481.0/1100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:24.808 immolate Fluffy_Pillow 956356.4/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:25.653 incinerate Fluffy_Pillow 906919.1/1100000: 82% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:26.668 incinerate Fluffy_Pillow 860543.6/1100000: 78% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:27.729 incinerate Fluffy_Pillow 814448.8/1100000: 74% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, potion_of_deadly_grace
0:28.788 incinerate Fluffy_Pillow 768316.5/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames
0:29.847 incinerate Fluffy_Pillow 722379.1/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando(2)
0:30.875 immolate Fluffy_Pillow 676242.2/1100000: 61% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando(3)
0:31.719 conflagrate Fluffy_Pillow 626785.4/1100000: 57% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando(3)
0:32.563 chaos_bolt Fluffy_Pillow 643328.5/1100000: 58% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, accelerando(3)
0:34.251 chaos_bolt Fluffy_Pillow 676414.9/1100000: 61% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
0:35.266 conflagrate Fluffy_Pillow 696309.8/1100000: 63% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
0:36.109 chaos_bolt Fluffy_Pillow 712833.4/1100000: 65% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:37.123 conflagrate Fluffy_Pillow 732708.7/1100000: 67% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:37.969 conflagrate Fluffy_Pillow 749291.1/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
0:38.814 chaos_bolt Fluffy_Pillow 765853.9/1100000: 70% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:39.827 life_tap Fluffy_Pillow 785709.6/1100000: 71% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:40.673 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:41.695 havoc enemy2 1034173.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:42.843 conflagrate Fluffy_Pillow 962740.4/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:43.990 chaos_bolt Fluffy_Pillow 979293.3/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:46.280 dimensional_rift Fluffy_Pillow 1012625.2/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:47.406 chaos_bolt Fluffy_Pillow 1029151.7/1100000: 94% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:48.742 chaos_bolt Fluffy_Pillow 1049007.7/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:50.079 chaos_bolt Fluffy_Pillow 1069003.3/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
0:51.396 incinerate Fluffy_Pillow 1088861.6/1100000: 99% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:52.696 incinerate Fluffy_Pillow 1034091.8/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:53.994 immolate Fluffy_Pillow 987942.4/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:55.077 incinerate Fluffy_Pillow 938504.9/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:56.375 chaos_bolt Fluffy_Pillow 892355.5/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
0:58.537 incinerate Fluffy_Pillow 924061.3/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
0:59.915 life_tap Fluffy_Pillow 877947.8/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:01.063 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:02.212 havoc enemy2 1034087.9/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:03.340 conflagrate Fluffy_Pillow 962609.4/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:04.473 chaos_bolt Fluffy_Pillow 979204.1/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:06.731 conflagrate Fluffy_Pillow 1012276.4/1100000: 92% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:07.861 chaos_bolt Fluffy_Pillow 1028827.2/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:09.218 conflagrate Fluffy_Pillow 1048836.5/1100000: 95% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:10.315 chaos_bolt Fluffy_Pillow 1065376.6/1100000: 97% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:11.632 conflagrate Fluffy_Pillow 1085233.9/1100000: 99% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:12.730 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:14.048 immolate enemy2 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:15.194 chaos_bolt Fluffy_Pillow 1034043.3/1100000: 94% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:16.570 conflagrate Fluffy_Pillow 1053902.0/1100000: 96% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:17.917 chaos_bolt Fluffy_Pillow 1073631.1/1100000: 98% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:19.272 life_tap Fluffy_Pillow 1093478.3/1100000: 99% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:20.377 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:21.695 incinerate Fluffy_Pillow 1034075.4/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:23.013 havoc enemy2 987947.7/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:24.111 immolate Fluffy_Pillow 916502.9/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:25.210 chaos_bolt Fluffy_Pillow 867073.2/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
1:27.403 incinerate Fluffy_Pillow 900139.6/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:28.701 incinerate Fluffy_Pillow 853873.0/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:30.078 incinerate Fluffy_Pillow 807745.0/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:31.456 dimensional_rift Fluffy_Pillow 761631.5/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:32.603 incinerate Fluffy_Pillow 778184.3/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:33.979 service_imp Fluffy_Pillow 732042.0/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:35.125 immolate Fluffy_Pillow 748580.4/1100000: 68% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:36.271 conflagrate Fluffy_Pillow 699118.8/1100000: 64% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:37.408 conflagrate Fluffy_Pillow 715656.2/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:38.537 chaos_bolt Fluffy_Pillow 732192.4/1100000: 67% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:40.793 conflagrate Fluffy_Pillow 765601.5/1100000: 70% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:41.907 life_tap Fluffy_Pillow 782158.1/1100000: 71% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando(2)
1:43.021 havoc enemy2 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:44.137 chaos_bolt Fluffy_Pillow 1028586.3/1100000: 94% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:45.474 chaos_bolt Fluffy_Pillow 1048458.3/1100000: 95% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:46.791 conflagrate Fluffy_Pillow 1068315.6/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:47.889 chaos_bolt Fluffy_Pillow 1084870.8/1100000: 99% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:49.204 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:50.581 conflagrate Fluffy_Pillow 1034072.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:51.731 chaos_bolt Fluffy_Pillow 1050668.3/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:53.107 incinerate Fluffy_Pillow 1070674.7/1100000: 97% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:54.444 incinerate Fluffy_Pillow 1024545.6/1100000: 93% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:55.781 incinerate Fluffy_Pillow 978416.5/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:57.117 incinerate Fluffy_Pillow 932272.6/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:58.455 immolate Fluffy_Pillow 886158.4/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
1:59.571 incinerate Fluffy_Pillow 836744.7/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:00.907 life_tap Fluffy_Pillow 790600.8/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:02.021 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
2:04.246 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
2:05.385 incinerate Fluffy_Pillow 1028569.2/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
2:06.764 soul_harvest Fluffy_Pillow 982570.9/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:06.764 potion Fluffy_Pillow 982570.9/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
2:06.764 incinerate Fluffy_Pillow 982570.9/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:08.119 immolate Fluffy_Pillow 936417.2/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:09.249 conflagrate Fluffy_Pillow 886968.0/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:10.379 conflagrate Fluffy_Pillow 903518.8/1100000: 82% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:11.509 chaos_bolt Fluffy_Pillow 920069.6/1100000: 84% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, accelerando, potion_of_deadly_grace
2:13.764 conflagrate Fluffy_Pillow 953243.9/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:14.878 chaos_bolt Fluffy_Pillow 969800.5/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:16.214 dimensional_rift Fluffy_Pillow 989656.6/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:17.327 conflagrate Fluffy_Pillow 1006198.3/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:18.434 chaos_bolt Fluffy_Pillow 1022756.8/1100000: 93% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:19.809 incinerate Fluffy_Pillow 1042613.1/1100000: 95% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:21.163 life_tap Fluffy_Pillow 996444.8/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:22.295 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:23.649 conflagrate Fluffy_Pillow 1034043.9/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:24.821 havoc enemy2 1051209.9/1100000: 96% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:25.952 chaos_bolt Fluffy_Pillow 979775.3/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:28.208 incinerate Fluffy_Pillow 1012818.3/1100000: 92% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:29.562 incinerate Fluffy_Pillow 966650.6/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:30.897 immolate Fluffy_Pillow 920491.8/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:32.018 chaos_bolt Fluffy_Pillow 871036.2/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:32.925 incinerate Fluffy_Pillow 884125.4/1100000: 80% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:33.830 dimensional_rift Fluffy_Pillow 831185.9/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:34.584 incinerate Fluffy_Pillow 842067.2/1100000: 77% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:35.490 incinerate Fluffy_Pillow 789142.0/1100000: 72% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:36.397 incinerate Fluffy_Pillow 736231.3/1100000: 67% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, potion_of_deadly_grace
2:37.305 incinerate Fluffy_Pillow 683399.8/1100000: 62% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(2)
2:38.185 incinerate Fluffy_Pillow 630479.8/1100000: 57% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
2:39.052 incinerate Fluffy_Pillow 577552.1/1100000: 53% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
2:39.920 incinerate Fluffy_Pillow 524639.4/1100000: 48% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
2:40.788 incinerate Fluffy_Pillow 471726.8/1100000: 43% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
2:41.654 life_tap Fluffy_Pillow 418784.1/1100000: 38% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
2:42.409 immolate Fluffy_Pillow 760167.7/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
2:43.163 conflagrate Fluffy_Pillow 705536.2/1100000: 64% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(3)
2:44.452 chaos_bolt Fluffy_Pillow 725011.6/1100000: 66% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(4)
2:47.000 havoc enemy2 764012.5/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(5)
2:48.257 conflagrate Fluffy_Pillow 695506.7/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(5)
2:49.549 conflagrate Fluffy_Pillow 714964.3/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
2:50.900 chaos_bolt Fluffy_Pillow 734461.1/1100000: 67% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
2:52.520 conflagrate Fluffy_Pillow 757840.0/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
2:53.275 chaos_bolt Fluffy_Pillow 768735.7/1100000: 70% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
2:54.180 incinerate Fluffy_Pillow 781915.0/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:55.073 incinerate Fluffy_Pillow 728994.5/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:55.965 incinerate Fluffy_Pillow 676085.3/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
2:56.844 incinerate Fluffy_Pillow 623149.2/1100000: 57% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
2:57.723 conflagrate Fluffy_Pillow 570213.2/1100000: 52% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
2:58.477 chaos_bolt Fluffy_Pillow 581419.4/1100000: 53% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(2)
2:59.940 incinerate Fluffy_Pillow 603163.0/1100000: 55% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
3:00.820 dimensional_rift Fluffy_Pillow 550242.9/1100000: 50% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
3:01.575 life_tap Fluffy_Pillow 561626.5/1100000: 51% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
3:02.320 chaos_bolt Fluffy_Pillow 902992.6/1100000: 82% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:03.174 berserking Fluffy_Pillow 916053.0/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:03.174 incinerate Fluffy_Pillow 916053.0/1100000: 83% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:03.930 incinerate Fluffy_Pillow 863348.9/1100000: 78% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
3:04.686 immolate Fluffy_Pillow 810644.9/1100000: 74% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(4)
3:05.803 service_imp Fluffy_Pillow 764116.3/1100000: 69% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:06.978 incinerate Fluffy_Pillow 783616.8/1100000: 71% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
3:08.387 havoc enemy2 741000.7/1100000: 67% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, devils_due
3:09.552 incinerate Fluffy_Pillow 672504.1/1100000: 61% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, devils_due, accelerando
3:10.941 incinerate Fluffy_Pillow 629900.0/1100000: 57% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, devils_due, accelerando
3:12.331 incinerate Fluffy_Pillow 587312.8/1100000: 53% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando
3:13.511 immolate Fluffy_Pillow 540448.0/1100000: 49% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:14.640 conflagrate Fluffy_Pillow 490984.2/1100000: 45% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:15.769 conflagrate Fluffy_Pillow 507520.3/1100000: 46% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
3:16.899 chaos_bolt Fluffy_Pillow 524071.1/1100000: 48% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:19.156 conflagrate Fluffy_Pillow 557379.7/1100000: 51% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:20.268 chaos_bolt Fluffy_Pillow 573911.6/1100000: 52% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:21.584 conflagrate Fluffy_Pillow 593292.3/1100000: 54% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:22.793 life_tap Fluffy_Pillow 610983.0/1100000: 56% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, accelerando
3:23.923 chaos_bolt Fluffy_Pillow 957533.8/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:25.278 chaos_bolt Fluffy_Pillow 977380.1/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:26.635 incinerate Fluffy_Pillow 997255.7/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:27.991 incinerate Fluffy_Pillow 951116.6/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:29.346 havoc enemy2 904962.9/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:30.475 conflagrate Fluffy_Pillow 833499.1/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:31.602 chaos_bolt Fluffy_Pillow 850039.6/1100000: 77% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:33.827 incinerate Fluffy_Pillow 883038.0/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:35.203 incinerate Fluffy_Pillow 836895.6/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:36.579 immolate Fluffy_Pillow 790753.2/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:37.728 incinerate Fluffy_Pillow 741334.9/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:39.105 incinerate Fluffy_Pillow 695207.0/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
3:40.481 incinerate Fluffy_Pillow 649098.6/1100000: 59% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:41.836 life_tap Fluffy_Pillow 602945.8/1100000: 55% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:42.951 chaos_bolt Fluffy_Pillow 949517.3/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:45.176 incinerate Fluffy_Pillow 982667.8/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:46.494 dimensional_rift Fluffy_Pillow 936540.1/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:47.583 immolate Fluffy_Pillow 953081.9/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
3:48.666 conflagrate Fluffy_Pillow 903644.4/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
3:49.749 havoc enemy2 920207.0/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:50.832 conflagrate Fluffy_Pillow 848769.5/1100000: 77% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:51.914 chaos_bolt Fluffy_Pillow 865316.8/1100000: 79% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(4)
3:54.075 conflagrate Fluffy_Pillow 896982.0/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:55.205 conflagrate Fluffy_Pillow 913532.8/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:56.495 summon_doomguard Fluffy_Pillow 932427.0/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:57.625 chaos_bolt Fluffy_Pillow 948977.8/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:58.981 incinerate Fluffy_Pillow 968838.8/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:00.338 incinerate Fluffy_Pillow 922727.5/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:01.674 incinerate Fluffy_Pillow 876584.4/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:02.990 conflagrate Fluffy_Pillow 830426.6/1100000: 75% mana | 1.0/5: 20% soul_shard lord_of_flames, accelerando(3)
4:04.091 life_tap Fluffy_Pillow 847027.1/1100000: 77% mana | 2.0/5: 40% soul_shard lord_of_flames, accelerando(3)
4:05.181 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
4:07.341 soul_harvest Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:07.341 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:08.697 incinerate Fluffy_Pillow 1034073.2/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando
4:10.053 havoc enemy2 987934.2/1100000: 90% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:10.808 immolate Fluffy_Pillow 910992.5/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:11.560 incinerate Fluffy_Pillow 856045.2/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(2)
4:12.440 chaos_bolt Fluffy_Pillow 803205.6/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3)
4:13.882 incinerate Fluffy_Pillow 825030.1/1100000: 75% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:14.737 incinerate Fluffy_Pillow 772105.8/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:15.591 incinerate Fluffy_Pillow 719166.2/1100000: 65% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:16.444 incinerate Fluffy_Pillow 666211.4/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:17.297 incinerate Fluffy_Pillow 613256.5/1100000: 56% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:18.152 incinerate Fluffy_Pillow 560332.2/1100000: 51% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(4)
4:19.006 incinerate Fluffy_Pillow 507279.7/1100000: 46% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact
4:19.912 chaos_bolt Fluffy_Pillow 454354.6/1100000: 41% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact
4:21.417 immolate Fluffy_Pillow 476074.5/1100000: 43% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:22.169 conflagrate Fluffy_Pillow 421088.8/1100000: 38% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, devils_due, accelerando
4:23.500 life_tap Fluffy_Pillow 440583.6/1100000: 40% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
4:24.832 chaos_bolt Fluffy_Pillow 790093.1/1100000: 72% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
4:26.427 conflagrate Fluffy_Pillow 813795.4/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(3)
4:27.721 chaos_bolt Fluffy_Pillow 833305.9/1100000: 76% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(3)
4:29.271 conflagrate Fluffy_Pillow 856677.1/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(4)
4:30.545 havoc enemy2 876160.6/1100000: 80% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:31.629 conflagrate Fluffy_Pillow 804738.5/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:32.712 dimensional_rift Fluffy_Pillow 821301.1/1100000: 75% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:33.817 chaos_bolt Fluffy_Pillow 837852.8/1100000: 76% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
4:36.107 conflagrate Fluffy_Pillow 871269.3/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:37.237 service_imp Fluffy_Pillow 887820.1/1100000: 81% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:38.367 chaos_bolt Fluffy_Pillow 904370.9/1100000: 82% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:39.721 chaos_bolt Fluffy_Pillow 924473.9/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:41.037 incinerate Fluffy_Pillow 944316.0/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:42.355 conflagrate Fluffy_Pillow 898188.3/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
4:43.466 immolate Fluffy_Pillow 914939.6/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:44.562 life_tap Fluffy_Pillow 865464.6/1100000: 79% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:45.659 immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
4:46.773 chaos_bolt Fluffy_Pillow 1034288.6/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
4:49.064 conflagrate Fluffy_Pillow 1067352.1/1100000: 97% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:50.196 chaos_bolt Fluffy_Pillow 1083932.2/1100000: 99% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:51.553 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
4:52.662 incinerate Fluffy_Pillow 1028563.7/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:53.979 incinerate Fluffy_Pillow 982420.9/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:55.297 incinerate Fluffy_Pillow 936293.2/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
4:56.613 conflagrate Fluffy_Pillow 890135.4/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
4:57.710 chaos_bolt Fluffy_Pillow 906675.6/1100000: 82% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52586 52586 34192
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3155160 3155160 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 20.62% 20.62% 6248
Haste 31.19% 30.19% 11323
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14431 14321 0
Mastery 50.43% 50.43% 3523
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 906.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Sephuz's Secret
ilevel: 940, stats: { +2658 Sta, +1068 Haste, +2671 Crit }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Sephuz"
level=110
race=troll
role=spell
position=back
talents=2303021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=sephuzs_secret,id=132452,ilevel=940,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=906.27
# gear_stamina=34192
# gear_intellect=38456
# gear_crit_rating=6248
# gear_haste_rating=11323
# gear_mastery_rating=3523
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Sindorei_Spite : 1010971 dps, 586998 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1010971.4 1010971.4 710.9 / 0.070% 140034.9 / 13.9% 32.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
25589.0 25589.0 Mana 0.00% 51.4 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sindorei_Spite 1010971
Chaos Bolt 305770 30.3% 58.2 5.02sec 1580378 1057380 Direct 111.6 0 823534 823534 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.16 111.61 0.00 0.00 1.4946 0.0000 91915941.33 91915941.33 0.00 1057380.15 1057380.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 111.61 100.00% 823534.43 522748 1330306 824343.67 773421 885434 91915941 91915941 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 111745 11.1% 48.6 6.18sec 690369 669144 Direct 97.2 202265 459667 345313 55.6%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.61 97.19 0.00 0.00 1.0317 0.0000 33558929.27 33558929.27 0.00 669144.39 669144.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.18 44.43% 202264.53 130026 330818 202406.91 179860 231127 8733203 8733203 0.00
crit 54.01 55.57% 459666.89 260002 765371 460004.77 411621 515033 24825726 24825726 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 14735 1.4% 32.7 5.03sec 132988 0 Direct 32.7 114956 229735 132989 15.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.73 32.73 0.00 0.00 0.0000 0.0000 4353090.80 4353090.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.59 84.29% 114956.37 86750 131686 114954.43 107060 122411 3171721 3171721 0.00
crit 5.14 15.71% 229735.29 173500 263373 228760.50 0 263373 1181369 1181369 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 255369 25.3% 20.0 15.26sec 3840799 3666115 Direct 38.8 137938 276034 203761 47.7%  
Periodic 298.5 155978 312144 230493 47.7% 196.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.97 38.82 298.48 298.48 1.0477 1.9843 76706121.87 76706121.87 0.00 125092.13 3666114.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.32 52.34% 137938.00 90189 229510 137938.35 118544 163829 2802268 2802268 0.00
crit 18.50 47.66% 276033.74 180415 459033 276013.41 228301 319307 5107006 5107006 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 156.1 52.29% 155977.59 99 474218 156250.17 133278 180801 24342625 24342625 0.00
crit 142.4 47.71% 312144.23 159 948491 312701.30 258013 361566 44454223 44454223 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 130589 13.0% 76.7 3.73sec 512437 424503 Direct 147.9 229685 459321 265778 15.7%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.71 147.91 0.00 0.00 1.2072 0.0000 39310719.71 39310719.71 0.00 424503.47 424503.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 124.66 84.28% 229684.61 145793 371018 229776.28 215810 246288 28632216 28632216 0.00
crit 23.25 15.72% 459320.61 291619 742011 459529.82 390808 537681 10678504 10678504 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9938 1.0% 20.0 15.02sec 149097 0 Direct 20.0 129075 258117 149098 15.5%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.04 20.04 0.00 0.00 0.0000 0.0000 2987620.33 2987620.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.93 84.48% 129075.21 110344 167502 129127.04 119680 144136 2185082 2185082 0.00
crit 3.11 15.52% 258117.44 220687 335003 247250.75 0 335003 802538 802538 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 43256 / 43256
Firebolt 43256 4.3% 109.1 2.76sec 119149 95808 Direct 108.3 103775 207482 120062 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.11 108.28 0.00 0.00 1.2436 0.0000 12999900.40 12999900.40 0.00 95808.00 95808.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.27 84.30% 103775.33 65104 134765 103829.57 101128 106534 9471831 9471831 0.00
crit 17.00 15.70% 207481.96 130208 269531 207569.12 184100 235490 3528069 3528069 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 129039 / 41084
Firebolt 129039 4.1% 49.2 5.53sec 250152 213159 Direct 48.9 217379 435068 251522 15.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.21 48.94 0.00 0.00 1.1736 0.0000 12309310.11 12309310.11 0.00 213159.30 213159.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.26 84.32% 217378.62 130208 269531 217721.95 205986 233027 8970041 8970041 0.00
crit 7.68 15.68% 435068.47 260416 539061 435383.94 0 539061 3339269 3339269 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 122080 / 10330
Immolation 93991 0.8% 1.0 0.00sec 2349873 0 Periodic 44.1 45998 92053 53232 15.7% 8.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.07 44.14 0.0000 1.0973 2349872.92 2349872.92 0.00 97022.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.2 84.29% 45998.17 34482 47586 45998.38 45162 47321 1711661 1711661 0.00
crit 6.9 15.71% 92053.43 68965 95171 92020.57 0 95171 638212 638212 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 28089 0.2% 22.1 1.10sec 31816 28994 Direct 22.1 27510 55018 31816 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.07 22.07 0.00 0.00 1.0973 0.0000 702243.84 1032364.96 31.98 28994.38 28994.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.62 84.35% 27509.84 20621 28456 27509.82 26669 28456 512161 752925 31.98
crit 3.45 15.65% 55018.10 41241 56913 53641.01 0 56913 190083 279440 31.19
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 109492 / 9250
Doom Bolt 109492 0.9% 10.9 2.25sec 250226 111548 Direct 10.9 216512 433006 250234 15.6%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.94 10.94 0.00 0.00 2.2433 0.0000 2737390.48 2737390.48 0.00 111548.10 111548.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.24 84.42% 216512.24 209378 251254 216508.04 209378 251254 1999442 1999442 0.00
crit 1.70 15.58% 433006.21 418757 502508 365118.58 0 502508 737949 737949 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 122081 / 10331
Immolation 94016 0.8% 1.0 0.00sec 2350494 0 Periodic 44.1 46002 92008 53246 15.7% 8.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.07 44.14 0.0000 1.0973 2350494.25 2350494.25 0.00 97047.66 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.2 84.26% 46002.40 34482 47586 46003.06 45095 47345 1711040 1711040 0.00
crit 6.9 15.74% 92008.07 68965 95171 91931.77 0 95171 639455 639455 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 28065 0.2% 22.1 1.10sec 31788 28970 Direct 22.1 27511 55002 31789 15.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.07 22.07 0.00 0.00 1.0973 0.0000 701641.93 1031480.09 31.98 28969.53 28969.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.64 84.44% 27511.30 20621 28456 27511.59 26669 28456 512763 753809 31.98
crit 3.43 15.56% 55002.32 41241 56913 53693.28 0 56913 188879 277671 31.22
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 122077 / 10331
Immolation 93963 0.8% 1.0 0.00sec 2349170 0 Periodic 44.1 46003 92006 53214 15.7% 8.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.07 44.14 0.0000 1.0973 2349170.20 2349170.20 0.00 96992.99 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.2 84.32% 46002.57 34482 47586 46003.13 44942 47119 1712364 1712364 0.00
crit 6.9 15.68% 92006.16 68965 95171 91953.98 0 95171 636807 636807 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 28114 0.2% 22.1 1.10sec 31844 29020 Direct 22.1 27507 55047 31844 15.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.07 22.07 0.00 0.00 1.0973 0.0000 702871.06 1033287.03 31.98 29020.27 29020.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 84.25% 27507.10 20621 28456 27507.13 26732 28456 511533 752003 31.98
crit 3.48 15.75% 55047.49 41241 56913 53801.67 0 56913 191338 281284 31.26
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 122106 / 10333
Immolation 93980 0.8% 1.0 0.00sec 2349586 0 Periodic 44.1 46003 92002 53225 15.7% 8.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.07 44.14 0.0000 1.0973 2349586.34 2349586.34 0.00 97010.17 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.2 84.30% 46002.95 34482 47586 46003.50 45107 47157 1711947 1711947 0.00
crit 6.9 15.70% 92002.13 68965 95171 91959.12 0 95171 637639 637639 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 28127 0.2% 22.1 1.10sec 31859 29034 Direct 22.1 27508 55043 31858 15.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.07 22.07 0.00 0.00 1.0973 0.0000 703196.91 1033766.07 31.98 29033.73 29033.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.58 84.20% 27507.55 20621 28456 27507.63 26763 28456 511208 751524 31.98
crit 3.49 15.80% 55042.59 41241 56913 53842.30 0 56913 191989 282243 31.27
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 120036 / 20442
Shadow Bolt 120036 2.0% 4.4 59.86sec 1391534 0 Periodic 46.5 113587 227136 131387 15.7% 19.8%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.40 0.00 46.80 46.55 0.0000 1.2767 6115847.88 6115847.88 0.00 102347.01 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.3 84.32% 113586.91 71 146419 113299.70 0 146419 4458363 4458363 0.00
crit 7.3 15.68% 227135.58 140 292838 223860.93 0 292838 1657485 1657485 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 141529 / 9642
Chaos Bolt 141529 1.0% 4.3 59.50sec 670414 324392 Direct 4.3 0 674588 674588 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.28 0.00 0.00 2.0669 0.0000 2889359.37 2889359.37 0.00 324391.98 324391.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.28 100.00% 674588.32 613669 846864 675486.06 0 846864 2889359 2889359 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 241899 / 18167
Chaos Barrage 241899 1.8% 4.4 59.98sec 1240709 0 Periodic 145.5 32263 64532 37341 15.7% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.38 0.00 146.23 145.52 0.0000 0.1627 5433846.69 5433846.69 0.00 228418.46 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 122.6 84.26% 32263.32 152 40266 32170.68 0 40266 3956159 3956159 0.00
crit 22.9 15.74% 64532.15 304 80533 64338.63 0 80533 1477687 1477687 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Sindorei_Spite
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sindorei_Spite
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.73sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.0 23.58sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.02 0.00 0.00 0.00 0.9979 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sindorei_Spite
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sindorei_Spite
  • harmful:false
  • if_expr:
 
Havoc 15.0 20.69sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.05 0.00 0.00 0.00 1.0595 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.2 20.51sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.20 0.00 0.00 0.00 0.9955 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 91.98sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.67 0.00 0.00 0.00 0.9674 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 121.00sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0737 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7549 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.52% 78.52% 1.4(1.4) 19.3

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.76%
  • accelerando_2:24.69%
  • accelerando_3:14.63%
  • accelerando_4:6.55%
  • accelerando_5:2.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.7sec 180.7sec 6.85% 7.42% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.62% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.3 0.0 12.3sec 12.3sec 49.17% 47.30% 0.0(0.0) 0.8

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.17%

Trigger Attempt Success

  • trigger_pct:49.96%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.5sec 69.5sec 8.71% 8.71% 0.0(0.0) 3.2

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.71%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.2 33.0 11.7sec 5.0sec 59.71% 67.50% 33.0(33.0) 25.6

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 8.0 7.2 38.1sec 20.5sec 97.61% 95.92% 50.7(50.7) 7.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:97.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.91% 97.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.9sec 69.2sec 13.56% 13.56% 0.0(0.0) 3.3

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.56%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 127.8sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Sin'dorei Spite 2.0 0.0 231.8sec 231.8sec 16.92% 16.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_sindorei_spite
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • sindorei_spite_1:16.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208871
  • name:Sin'dorei Spite
  • tooltip:You and your minions deal {$s1=15}% increased damage.
  • description:{$@spelldesc208868=For {$208871d=25 seconds} after casting Summon Doomguard or Summon Infernal, you and your minions deal {$208871s1=15}% increased damage.{$?s152107=false}[ This effect can be gained only once every {$s1=3} min.][]}
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:0.00%
Soul Harvest 2.9 0.0 121.0sec 121.0sec 17.77% 17.77% 0.0(0.0) 2.7

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.4 59.5sec
chaos_tear 4.3 59.7sec
chaos_portal 4.4 59.6sec
dimension_ripper 3.9 55.1sec

Resources

Resource Usage Type Count Total Average RPE APR
Sindorei_Spite
chaos_bolt Soul Shard 59.2 118.3 2.0 2.0 776824.2
havoc Mana 15.0 1324020.4 88000.0 87999.9 0.0
immolate Mana 20.0 1318099.8 66000.0 65999.4 58.2
incinerate Mana 76.7 5063076.9 66000.0 66000.0 7.8
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 109.1 4364.3 40.0 40.0 2978.7
pet - service_imp
firebolt Energy 49.2 1968.4 40.0 40.0 6253.6
pet - doomguard
doom_bolt Energy 10.9 382.9 35.0 35.0 7149.3
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.20 3616684.38 (47.74%) 237917.23 1399790.68 27.90%
immolate Soul Shard 66.14 65.38 (53.26%) 0.99 0.76 1.15%
conflagrate Soul Shard 48.61 48.53 (39.54%) 1.00 0.08 0.16%
mp5_regen Mana 482.93 3958414.52 (52.26%) 8196.66 686963.97 14.79%
soulsnatcher Soul Shard 8.84 8.84 (7.20%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1869.23 4198.26 (100.00%) 2.25 22.82 0.54%
pet - service_imp
energy_regen Energy 424.99 1347.70 (100.00%) 3.17 63.80 4.52%
pet - doomguard
energy_regen Energy 10.94 347.80 (100.00%) 31.79 45.51 11.57%
Resource RPS-Gain RPS-Loss
Health 0.00 16036.72
Mana 25156.94 25589.00
Soul Shard 0.41 0.41
Combat End Resource Mean Min Max
Mana 970224.48 496341.42 1100000.00
Soul Shard 1.77 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 13.7%

Statistics & Data Analysis

Fight Length
Sample Data Sindorei_Spite Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Sindorei_Spite Damage Per Second
Count 9999
Mean 1010971.43
Minimum 908122.66
Maximum 1154892.21
Spread ( max - min ) 246769.55
Range [ ( max - min ) / 2 * 100% ] 12.20%
Standard Deviation 36267.8226
5th Percentile 954730.40
95th Percentile 1074075.75
( 95th Percentile - 5th Percentile ) 119345.35
Mean Distribution
Standard Deviation 362.6964
95.00% Confidence Intervall ( 1010260.56 - 1011682.30 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4944
0.1 Scale Factor Error with Delta=300 11228627
0.05 Scale Factor Error with Delta=300 44914506
0.01 Scale Factor Error with Delta=300 1122862647
Priority Target DPS
Sample Data Sindorei_Spite Priority Target Damage Per Second
Count 9999
Mean 586997.71
Minimum 526147.04
Maximum 679332.13
Spread ( max - min ) 153185.08
Range [ ( max - min ) / 2 * 100% ] 13.05%
Standard Deviation 21977.3907
5th Percentile 552948.66
95th Percentile 625979.66
( 95th Percentile - 5th Percentile ) 73030.99
Mean Distribution
Standard Deviation 219.7849
95.00% Confidence Intervall ( 586566.94 - 587428.48 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5385
0.1 Scale Factor Error with Delta=300 4123215
0.05 Scale Factor Error with Delta=300 16492858
0.01 Scale Factor Error with Delta=300 412321449
DPS(e)
Sample Data Sindorei_Spite Damage Per Second (Effective)
Count 9999
Mean 1010971.43
Minimum 908122.66
Maximum 1154892.21
Spread ( max - min ) 246769.55
Range [ ( max - min ) / 2 * 100% ] 12.20%
Damage
Sample Data Sindorei_Spite Damage
Count 9999
Mean 248832423.30
Minimum 174858397.69
Maximum 328098528.10
Spread ( max - min ) 153240130.41
Range [ ( max - min ) / 2 * 100% ] 30.79%
DTPS
Sample Data Sindorei_Spite Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sindorei_Spite Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sindorei_Spite Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sindorei_Spite Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sindorei_Spite Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sindorei_Spite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Sindorei_SpiteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Sindorei_Spite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 15.05 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.20 immolate,if=remains<=tick_time
F 0.56 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.25 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.88 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.73 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
L 14.20 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
M 3.67 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.89 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 12.02 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 58.48 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 77.03 incinerate
0.00 life_tap

Sample Sequence

01269ABCDEGHJKMKNPQQRKRRKRSRSKRLCSSSSERSRSGJKRKRSKRLCRSKQRSSSSSSRERSRSLSCGJKKRRKRSSSKLRCRSSSESSSRQSSMGJKLRCKKRSQRKRSSSSSLESRSCRSSPISGJKRKQRKLRSSSSCKRSSSEQSSSSLRGCJKRKRRSSFKRSSSSKLQHRCEMSSSSSSGJKRKLRKCRSSKRSSSSESLSSQCRGJRKRKORKRLSKRCPSSSESSSSRSLGJKRCQRKJRSMJSSLRSSJRERSCSRJRSS

Sample Sequence Table

time name target resources buffs
Pre flask Sindorei_Spite 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Sindorei_Spite 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Sindorei_Spite 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.108 dimensional_rift Fluffy_Pillow 1032924.3/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.985 immolate Fluffy_Pillow 1049486.3/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.862 immolate Fluffy_Pillow 1000048.2/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.743 berserking Fluffy_Pillow 950685.7/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.743 conflagrate Fluffy_Pillow 950685.7/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:04.504 conflagrate Fluffy_Pillow 967212.7/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, accelerando, potion_of_deadly_grace
0:05.254 service_imp Fluffy_Pillow 983742.6/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:06.009 conflagrate Fluffy_Pillow 1000382.6/1100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:06.765 summon_infernal Fluffy_Pillow 1017044.7/1100000: 92% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, accelerando(2), potion_of_deadly_grace
0:07.520 soul_harvest Fluffy_Pillow 1033684.8/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, sindorei_spite, accelerando(2), potion_of_deadly_grace
0:07.520 dimensional_rift Fluffy_Pillow 1033684.8/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, sindorei_spite, accelerando(2), potion_of_deadly_grace
0:08.273 dimensional_rift Fluffy_Pillow 1050280.7/1100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, sindorei_spite, accelerando(2), potion_of_deadly_grace
0:09.027 chaos_bolt Fluffy_Pillow 1066898.8/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, sindorei_spite, accelerando(2), potion_of_deadly_grace
0:10.527 conflagrate Fluffy_Pillow 1099958.5/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2), potion_of_deadly_grace
0:11.282 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2), potion_of_deadly_grace
0:12.186 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando, potion_of_deadly_grace
0:13.101 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando, potion_of_deadly_grace
0:13.883 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando, potion_of_deadly_grace
0:14.935 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando, potion_of_deadly_grace
0:15.986 chaos_bolt Fluffy_Pillow 1034057.5/1100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando(2), potion_of_deadly_grace
0:17.023 incinerate Fluffy_Pillow 1053931.7/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando(2), potion_of_deadly_grace
0:18.061 conflagrate Fluffy_Pillow 1007826.4/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando(3), potion_of_deadly_grace
0:18.910 chaos_bolt Fluffy_Pillow 1024423.1/1100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(4), potion_of_deadly_grace
0:19.917 life_tap Fluffy_Pillow 1044286.5/1100000: 95% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(4), potion_of_deadly_grace
0:20.758 havoc enemy2 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(4), potion_of_deadly_grace
0:21.598 incinerate Fluffy_Pillow 1028569.2/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(4), potion_of_deadly_grace
0:22.605 incinerate Fluffy_Pillow 982612.2/1100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(5), potion_of_deadly_grace
0:23.598 incinerate Fluffy_Pillow 936477.3/1100000: 85% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(5), potion_of_deadly_grace
0:24.590 incinerate Fluffy_Pillow 889622.2/1100000: 81% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, sindorei_spite, potion_of_deadly_grace
0:25.658 immolate Fluffy_Pillow 843492.2/1100000: 77% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, sindorei_spite, potion_of_deadly_grace
0:26.548 chaos_bolt Fluffy_Pillow 794050.6/1100000: 72% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, sindorei_spite, potion_of_deadly_grace
0:28.326 incinerate Fluffy_Pillow 827130.0/1100000: 75% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, sindorei_spite
0:29.394 chaos_bolt Fluffy_Pillow 781000.0/1100000: 71% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, sindorei_spite
0:30.460 incinerate Fluffy_Pillow 800833.7/1100000: 73% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, sindorei_spite, accelerando
0:31.512 immolate Fluffy_Pillow 754700.5/1100000: 69% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, sindorei_spite, accelerando
0:32.389 conflagrate Fluffy_Pillow 705262.4/1100000: 64% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:33.266 conflagrate Fluffy_Pillow 721824.3/1100000: 66% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:34.142 chaos_bolt Fluffy_Pillow 738367.4/1100000: 67% mana | 4.0/5: 80% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:35.195 conflagrate Fluffy_Pillow 758253.1/1100000: 69% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:36.073 chaos_bolt Fluffy_Pillow 774833.9/1100000: 70% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:37.128 incinerate Fluffy_Pillow 794757.3/1100000: 72% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:38.180 conflagrate Fluffy_Pillow 748624.1/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:39.058 chaos_bolt Fluffy_Pillow 765204.9/1100000: 70% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:40.113 life_tap Fluffy_Pillow 785128.4/1100000: 71% mana | 2.0/5: 40% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:40.990 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:42.125 chaos_bolt Fluffy_Pillow 1028487.9/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:43.491 incinerate Fluffy_Pillow 1048142.4/1100000: 95% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:44.859 conflagrate Fluffy_Pillow 1002014.9/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:45.992 dimensional_rift Fluffy_Pillow 1018552.4/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:47.233 chaos_bolt Fluffy_Pillow 1036847.7/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:48.581 incinerate Fluffy_Pillow 1056720.4/1100000: 96% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
0:49.466 incinerate Fluffy_Pillow 1003788.2/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
0:50.341 incinerate Fluffy_Pillow 950876.2/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
0:51.217 incinerate Fluffy_Pillow 897979.1/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
0:52.092 incinerate Fluffy_Pillow 845067.0/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
0:52.965 incinerate Fluffy_Pillow 792125.7/1100000: 72% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
0:53.828 chaos_bolt Fluffy_Pillow 739220.2/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
0:55.263 immolate Fluffy_Pillow 760993.9/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
0:56.055 chaos_bolt Fluffy_Pillow 706407.4/1100000: 64% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:56.954 incinerate Fluffy_Pillow 719466.9/1100000: 65% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:57.854 chaos_bolt Fluffy_Pillow 666541.0/1100000: 61% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:58.754 incinerate Fluffy_Pillow 679615.0/1100000: 62% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
0:59.655 life_tap Fluffy_Pillow 626704.9/1100000: 57% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:00.409 incinerate Fluffy_Pillow 967820.7/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:01.996 havoc enemy2 925216.8/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando(2)
1:03.320 immolate Fluffy_Pillow 856735.6/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
1:04.642 conflagrate Fluffy_Pillow 810225.0/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
1:05.965 conflagrate Fluffy_Pillow 829729.1/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(2)
1:07.289 conflagrate Fluffy_Pillow 849248.0/1100000: 77% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2)
1:08.626 chaos_bolt Fluffy_Pillow 868729.9/1100000: 79% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:10.900 chaos_bolt Fluffy_Pillow 901763.7/1100000: 82% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:12.266 conflagrate Fluffy_Pillow 921607.3/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:13.404 chaos_bolt Fluffy_Pillow 938138.7/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:14.771 incinerate Fluffy_Pillow 957997.8/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
1:16.118 incinerate Fluffy_Pillow 911856.6/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:17.445 incinerate Fluffy_Pillow 865706.5/1100000: 79% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:18.754 conflagrate Fluffy_Pillow 819568.3/1100000: 75% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:19.842 life_tap Fluffy_Pillow 836119.0/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando(5)
1:20.612 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact
1:22.130 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
1:22.889 chaos_bolt Fluffy_Pillow 1022862.4/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
1:23.803 incinerate Fluffy_Pillow 1035943.0/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
1:24.718 incinerate Fluffy_Pillow 983038.0/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
1:25.631 incinerate Fluffy_Pillow 930104.4/1100000: 85% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
1:26.545 immolate Fluffy_Pillow 877185.0/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
1:27.308 incinerate Fluffy_Pillow 822104.6/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
1:28.222 incinerate Fluffy_Pillow 769258.9/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando
1:29.122 incinerate Fluffy_Pillow 716333.0/1100000: 65% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando
1:30.022 chaos_bolt Fluffy_Pillow 663407.1/1100000: 60% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, nefarious_pact, accelerando
1:31.518 dimensional_rift Fluffy_Pillow 685139.1/1100000: 62% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
1:32.272 incinerate Fluffy_Pillow 696092.3/1100000: 63% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando
1:33.882 incinerate Fluffy_Pillow 653804.8/1100000: 59% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(3)
1:35.446 service_imp Fluffy_Pillow 611199.6/1100000: 56% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(4)
1:36.733 immolate Fluffy_Pillow 630727.6/1100000: 57% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(4)
1:38.018 conflagrate Fluffy_Pillow 584303.2/1100000: 53% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(5)
1:39.286 conflagrate Fluffy_Pillow 603815.9/1100000: 55% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(5)
1:40.597 life_tap Fluffy_Pillow 623299.6/1100000: 57% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando
1:41.736 chaos_bolt Fluffy_Pillow 969845.6/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:44.012 havoc enemy2 1003230.5/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:45.120 conflagrate Fluffy_Pillow 931803.6/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:46.227 conflagrate Fluffy_Pillow 948361.7/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:47.330 chaos_bolt Fluffy_Pillow 964932.5/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
1:48.639 incinerate Fluffy_Pillow 984795.3/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
1:49.930 dimensional_rift Fluffy_Pillow 938662.0/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
1:51.006 chaos_bolt Fluffy_Pillow 955220.1/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(5)
1:52.297 conflagrate Fluffy_Pillow 975001.6/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:53.453 chaos_bolt Fluffy_Pillow 991545.6/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:54.839 incinerate Fluffy_Pillow 1011381.3/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:56.225 incinerate Fluffy_Pillow 965216.9/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:57.137 incinerate Fluffy_Pillow 912269.0/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:58.050 incinerate Fluffy_Pillow 859335.3/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact
1:58.964 incinerate Fluffy_Pillow 806416.0/1100000: 73% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
1:59.878 life_tap Fluffy_Pillow 753496.6/1100000: 68% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
2:00.640 immolate Fluffy_Pillow 1094401.9/1100000: 99% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
2:01.400 incinerate Fluffy_Pillow 1034042.9/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
2:02.314 chaos_bolt Fluffy_Pillow 981124.7/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
2:03.814 incinerate Fluffy_Pillow 1002914.8/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:04.714 havoc enemy2 949988.9/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:05.469 chaos_bolt Fluffy_Pillow 872956.6/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:06.369 incinerate Fluffy_Pillow 886030.6/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:07.267 incinerate Fluffy_Pillow 833075.6/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
2:08.168 soul_harvest Fluffy_Pillow 780164.2/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:08.168 potion Fluffy_Pillow 780164.2/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando
2:08.168 incinerate Fluffy_Pillow 780164.2/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
2:09.779 immolate Fluffy_Pillow 737566.8/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
2:11.121 conflagrate Fluffy_Pillow 691061.7/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_deadly_grace
2:12.463 conflagrate Fluffy_Pillow 710556.6/1100000: 65% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_deadly_grace
2:13.807 chaos_bolt Fluffy_Pillow 730080.6/1100000: 66% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, devils_due, accelerando, potion_of_deadly_grace
2:16.488 conflagrate Fluffy_Pillow 768570.8/1100000: 70% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:17.616 dimensional_rift Fluffy_Pillow 785113.5/1100000: 71% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:18.370 chaos_bolt Fluffy_Pillow 796229.2/1100000: 72% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:19.257 conflagrate Fluffy_Pillow 809305.7/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:20.013 life_tap Fluffy_Pillow 820450.9/1100000: 75% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:20.767 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:21.655 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:22.541 incinerate Fluffy_Pillow 1034059.0/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:23.427 incinerate Fluffy_Pillow 981120.7/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2), potion_of_deadly_grace
2:24.314 incinerate Fluffy_Pillow 928356.5/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:25.190 havoc enemy2 875459.4/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:25.944 conflagrate Fluffy_Pillow 798737.5/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:26.699 chaos_bolt Fluffy_Pillow 810030.5/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3), potion_of_deadly_grace
2:28.152 incinerate Fluffy_Pillow 831808.6/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4), potion_of_deadly_grace
2:29.013 incinerate Fluffy_Pillow 778497.6/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
2:30.624 incinerate Fluffy_Pillow 735900.2/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due, accelerando, potion_of_deadly_grace
2:32.235 immolate Fluffy_Pillow 693302.8/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando, potion_of_deadly_grace
2:33.576 dimensional_rift Fluffy_Pillow 646783.8/1100000: 59% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:34.899 incinerate Fluffy_Pillow 666287.9/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:36.485 incinerate Fluffy_Pillow 623669.3/1100000: 57% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(2), potion_of_deadly_grace
2:38.071 incinerate Fluffy_Pillow 581050.6/1100000: 53% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
2:39.420 incinerate Fluffy_Pillow 534938.1/1100000: 49% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:40.767 life_tap Fluffy_Pillow 488738.7/1100000: 44% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos
2:41.925 chaos_bolt Fluffy_Pillow 835311.3/1100000: 76% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
2:44.236 immolate Fluffy_Pillow 868449.9/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:45.375 havoc enemy2 818995.8/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:46.511 conflagrate Fluffy_Pillow 747564.0/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:47.266 conflagrate Fluffy_Pillow 758694.5/1100000: 69% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
2:48.019 chaos_bolt Fluffy_Pillow 769795.4/1100000: 70% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
2:48.907 conflagrate Fluffy_Pillow 782886.6/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
2:49.662 chaos_bolt Fluffy_Pillow 794017.1/1100000: 72% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:50.549 chaos_bolt Fluffy_Pillow 807093.6/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:51.435 incinerate Fluffy_Pillow 820155.3/1100000: 75% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:52.321 incinerate Fluffy_Pillow 767217.0/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
2:53.209 immolate enemy2 714309.5/1100000: 65% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:53.964 conflagrate Fluffy_Pillow 659602.5/1100000: 60% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:54.719 chaos_bolt Fluffy_Pillow 670895.6/1100000: 61% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:55.593 incinerate Fluffy_Pillow 683968.6/1100000: 62% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
2:56.468 incinerate Fluffy_Pillow 630712.1/1100000: 57% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact
2:57.384 incinerate Fluffy_Pillow 577939.8/1100000: 53% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
2:58.282 incinerate Fluffy_Pillow 524984.8/1100000: 48% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando
2:59.891 conflagrate Fluffy_Pillow 482358.3/1100000: 44% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando
3:01.313 life_tap Fluffy_Pillow 503015.4/1100000: 46% mana | 3.0/5: 60% soul_shard lord_of_flames, devils_due, accelerando
3:02.657 dimensional_rift Fluffy_Pillow 852539.3/1100000: 78% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando
3:03.979 berserking Fluffy_Pillow 872028.7/1100000: 79% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, devils_due, accelerando(2)
3:03.979 chaos_bolt Fluffy_Pillow 872028.7/1100000: 79% mana | 3.0/5: 60% soul_shard berserking, empowered_life_tap, lord_of_flames, devils_due, accelerando(2)
3:06.278 havoc enemy2 911006.7/1100000: 83% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:07.242 immolate Fluffy_Pillow 839588.8/1100000: 76% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:08.207 service_imp Fluffy_Pillow 790188.0/1100000: 72% mana | 1.0/5: 20% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:09.186 incinerate Fluffy_Pillow 806766.5/1100000: 73% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos
3:10.394 incinerate Fluffy_Pillow 760702.5/1100000: 69% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando
3:11.583 incinerate Fluffy_Pillow 714565.6/1100000: 65% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando
3:12.772 incinerate Fluffy_Pillow 668428.7/1100000: 61% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando
3:13.961 incinerate Fluffy_Pillow 622291.9/1100000: 57% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando
3:15.150 incinerate Fluffy_Pillow 573603.4/1100000: 52% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:16.519 immolate Fluffy_Pillow 527510.8/1100000: 48% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:17.642 conflagrate Fluffy_Pillow 478066.5/1100000: 43% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(2)
3:18.765 conflagrate Fluffy_Pillow 494637.4/1100000: 45% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:19.872 chaos_bolt Fluffy_Pillow 511195.5/1100000: 46% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
3:22.082 conflagrate Fluffy_Pillow 544506.3/1100000: 50% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(4)
3:23.232 life_tap Fluffy_Pillow 561070.9/1100000: 51% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, accelerando
3:24.372 chaos_bolt Fluffy_Pillow 907631.4/1100000: 83% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:25.740 conflagrate Fluffy_Pillow 927581.8/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:26.863 havoc enemy2 944137.5/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:27.987 chaos_bolt Fluffy_Pillow 872707.9/1100000: 79% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:29.334 incinerate Fluffy_Pillow 892565.8/1100000: 81% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:30.684 incinerate Fluffy_Pillow 846639.6/1100000: 77% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:32.011 conflagrate Fluffy_Pillow 800488.4/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
3:33.119 chaos_bolt Fluffy_Pillow 817061.5/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:34.448 incinerate Fluffy_Pillow 836972.1/1100000: 76% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
3:35.758 incinerate Fluffy_Pillow 790287.2/1100000: 72% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:37.145 incinerate Fluffy_Pillow 744137.1/1100000: 68% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:38.532 incinerate Fluffy_Pillow 697987.1/1100000: 63% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
3:39.920 immolate Fluffy_Pillow 651851.4/1100000: 59% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
3:41.078 incinerate Fluffy_Pillow 602424.0/1100000: 55% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
3:42.465 life_tap Fluffy_Pillow 556274.9/1100000: 51% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:43.604 incinerate Fluffy_Pillow 902820.8/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:44.971 incinerate Fluffy_Pillow 856678.9/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:46.338 dimensional_rift Fluffy_Pillow 810536.9/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:47.478 havoc enemy2 827097.4/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:48.618 chaos_bolt Fluffy_Pillow 755657.9/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:50.894 immolate Fluffy_Pillow 788872.6/1100000: 72% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:52.017 conflagrate Fluffy_Pillow 739428.2/1100000: 67% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:53.141 chaos_bolt Fluffy_Pillow 755998.6/1100000: 69% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:54.488 conflagrate Fluffy_Pillow 775846.0/1100000: 71% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:55.629 chaos_bolt Fluffy_Pillow 792421.0/1100000: 72% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:56.995 conflagrate Fluffy_Pillow 812264.6/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
3:58.134 summon_doomguard Fluffy_Pillow 828810.5/1100000: 75% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:59.273 chaos_bolt Fluffy_Pillow 845370.5/1100000: 77% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2)
4:00.618 conflagrate Fluffy_Pillow 865199.0/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(2)
4:01.736 chaos_bolt Fluffy_Pillow 881736.2/1100000: 80% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(3)
4:03.063 life_tap Fluffy_Pillow 901585.1/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(3)
4:04.171 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(3)
4:05.500 conflagrate Fluffy_Pillow 1034089.7/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, sindorei_spite, accelerando(3)
4:06.660 chaos_bolt Fluffy_Pillow 1051326.2/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite
4:08.046 havoc enemy2 1071161.9/1100000: 97% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite
4:09.201 soul_harvest Fluffy_Pillow 999691.6/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite
4:09.201 incinerate Fluffy_Pillow 999691.6/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite
4:10.588 incinerate Fluffy_Pillow 953581.6/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando
4:11.956 incinerate Fluffy_Pillow 907455.3/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando(2)
4:13.304 immolate Fluffy_Pillow 861328.0/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, sindorei_spite, accelerando(2)
4:14.428 incinerate Fluffy_Pillow 811898.4/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, sindorei_spite, accelerando(2)
4:15.773 incinerate Fluffy_Pillow 765726.8/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, sindorei_spite, accelerando(2)
4:17.118 incinerate Fluffy_Pillow 719555.3/1100000: 65% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, sindorei_spite, accelerando(2)
4:18.465 incinerate Fluffy_Pillow 673414.1/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, sindorei_spite, accelerando(3)
4:19.793 chaos_bolt Fluffy_Pillow 627277.9/1100000: 57% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, sindorei_spite, accelerando(3)
4:22.002 incinerate Fluffy_Pillow 660400.6/1100000: 60% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, sindorei_spite, accelerando(4)
4:23.310 life_tap Fluffy_Pillow 613464.7/1100000: 56% mana | 0.0/5: 0% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:24.468 immolate Fluffy_Pillow 960037.3/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:25.624 conflagrate Fluffy_Pillow 910581.4/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos
4:26.779 conflagrate Fluffy_Pillow 927111.1/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
4:27.934 chaos_bolt Fluffy_Pillow 943640.8/1100000: 86% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos
4:30.245 havoc enemy2 976714.5/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:31.402 dimensional_rift Fluffy_Pillow 905272.9/1100000: 82% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:32.559 chaos_bolt Fluffy_Pillow 921831.2/1100000: 84% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:33.947 conflagrate Fluffy_Pillow 941894.8/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:35.087 conflagrate Fluffy_Pillow 958455.3/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:36.226 chaos_bolt Fluffy_Pillow 975001.3/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:37.591 incinerate Fluffy_Pillow 994830.3/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:38.956 service_imp Fluffy_Pillow 948659.3/1100000: 86% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
4:40.095 conflagrate Fluffy_Pillow 965205.3/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:40.849 incinerate Fluffy_Pillow 976158.4/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:41.749 incinerate Fluffy_Pillow 923232.5/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
4:42.647 life_tap Fluffy_Pillow 870388.6/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:43.401 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(3)
4:44.856 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
4:45.717 incinerate Fluffy_Pillow 1034058.1/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:46.617 conflagrate Fluffy_Pillow 981132.2/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
4:47.367 chaos_bolt Fluffy_Pillow 992057.6/1100000: 90% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:48.255 immolate Fluffy_Pillow 1005148.8/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:49.008 chaos_bolt Fluffy_Pillow 950249.8/1100000: 86% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:49.894 incinerate Fluffy_Pillow 963311.5/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:50.781 havoc enemy2 910388.0/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:51.535 incinerate Fluffy_Pillow 833503.7/1100000: 76% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:52.421 chaos_bolt Fluffy_Pillow 780565.5/1100000: 71% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(2)
4:54.006 conflagrate Fluffy_Pillow 803932.7/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(3)
4:55.310 chaos_bolt Fluffy_Pillow 823437.5/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(3)
4:56.874 incinerate Fluffy_Pillow 846832.4/1100000: 77% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(4)
4:58.415 incinerate Fluffy_Pillow 803609.3/1100000: 73% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 52943 52943 34467
Intellect 50353 48647 39007 (1278)
Spirit 1 1 0
Health 3176580 3176580 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 50353 48647 0
Crit 15.68% 15.68% 4271
Haste 30.10% 29.10% 10914
Damage / Heal Versatility 5.36% 5.36% 2544
ManaReg per Second 14311 14201 0
Mastery 67.65% 67.65% 5819
Armor 1975 1975 1975
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 907.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Sin'dorei Spite
ilevel: 940, stats: { 157 Armor, +2658 Sta, +1772 Int, +694 Crit, +385 Haste }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Sindorei_Spite"
level=110
race=troll
role=spell
position=back
talents=2303021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=sindoreis_spite,id=132379,ilevel=940
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=907.27
# gear_stamina=34467
# gear_intellect=39007
# gear_crit_rating=4271
# gear_haste_rating=10914
# gear_mastery_rating=5819
# gear_versatility_rating=2544
# gear_armor=1975
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Warlock_Destruction_T19M : 956924 dps, 554254 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
956923.9 956923.9 612.2 / 0.064% 121451.5 / 12.7% 30.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
25824.8 25824.8 Mana 0.00% 51.7 100.0% 100%
Talents
  • 15: Roaring Blaze (Destruction Warlock)
  • 30: Empowered Life Tap
  • 60: Soul Harvest
  • 90: Grimoire of Service
  • 100: Wreak Havoc (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Warlock_Destruction_T19M 956924
Chaos Bolt 290080 30.4% 58.1 5.02sec 1502415 1009912 Direct 111.5 0 782455 782455 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.08 111.53 0.00 0.00 1.4877 0.0000 87263424.06 87263424.06 0.00 1009911.51 1009911.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 111.53 100.00% 782455.37 511892 1132774 782767.00 736740 833689 87263424 87263424 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.663000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 107373 11.2% 48.8 6.15sec 661278 643702 Direct 97.6 196682 441551 330747 54.8%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.80 97.56 0.00 0.00 1.0273 0.0000 32268777.67 32268777.67 0.00 643701.93 643701.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.14 45.25% 196681.78 129235 285984 196741.54 176109 215466 8682271 8682271 0.00
crit 53.42 54.75% 441550.71 258622 651720 441638.72 402735 484347 23586507 23586507 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of Incinerate and Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates 1 Soul Shard.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 13709 1.4% 32.8 5.00sec 123408 0 Direct 32.8 108394 216805 123407 13.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.83 32.83 0.00 0.00 0.0000 0.0000 4051255.14 4051255.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.28 86.15% 108394.15 87244 115162 108391.17 102878 112254 3065605 3065605 0.00
crit 4.55 13.85% 216804.64 174488 230324 215539.04 0 230324 985650 985650 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 243933 25.5% 20.0 15.18sec 3657021 3509975 Direct 38.9 134598 269167 196380 45.9%  
Periodic 300.1 150003 299950 218810 45.9% 196.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.05 38.91 300.15 300.15 1.0419 1.9734 73316348.11 73316348.11 0.00 119565.27 3509974.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.05 54.09% 134597.68 89660 198408 134550.82 118162 155258 2833074 2833074 0.00
crit 17.86 45.91% 269166.67 179334 396814 269084.97 219950 310670 4808361 4808361 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 162.4 54.11% 150002.90 77 409975 150169.89 131858 172034 24363364 24363364 0.00
crit 137.7 45.89% 299950.01 163 819942 300291.94 255744 348217 41311549 41311549 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage has a {$193541s1=15}% chance to generate 1 Soul Shard. Chance doubled on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 125230 13.1% 77.7 3.70sec 485427 404137 Direct 149.7 221220 442541 251992 13.9%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.70 149.68 0.00 0.00 1.2012 0.0000 37719296.03 37719296.03 0.00 404136.76 404136.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 128.87 86.10% 221220.34 144976 320737 221184.14 208243 235363 28509045 28509045 0.00
crit 20.81 13.90% 442540.54 289978 641469 442436.51 376087 517282 9210251 9210251 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage.{$?s29722=true}|!c3[][ Replaces Shadow Bolt.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mark of the Hidden Satyr 9510 1.0% 20.1 14.89sec 142049 0 Direct 20.1 124815 249380 142048 13.8%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.13 20.13 0.00 0.00 0.0000 0.0000 2859182.23 2859182.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.34 86.16% 124815.29 109698 144802 124817.03 118230 133832 2164694 2164694 0.00
crit 2.78 13.84% 249379.85 219396 289603 234938.41 0 289603 694489 694489 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - imp 41273 / 41273
Firebolt 41273 4.3% 109.7 2.75sec 113174 91489 Direct 108.8 100122 200156 114048 13.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.65 108.81 0.00 0.00 1.2370 0.0000 12409680.48 12409680.48 0.00 91489.16 91489.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.66 86.08% 100122.38 64723 116502 100128.14 98068 102380 9377807 9377807 0.00
crit 15.15 13.92% 200155.53 129446 233004 200147.44 168280 221908 3031874 3031874 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - service_imp 118783 / 37812
Firebolt 118783 3.9% 49.2 5.52sec 230287 197213 Direct 49.0 203257 406282 231523 13.9%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.24 48.97 0.00 0.00 1.1677 0.0000 11338774.52 11338774.52 0.00 197213.23 197213.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.16 86.08% 203257.07 129446 233004 203404.66 196759 211302 8568564 8568564 0.00
crit 6.82 13.92% 406282.25 258893 466007 406254.54 0 466007 2770210 2770210 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=1} Fire damage to a target.$?a231795[ Damage increased by {$231795s1=50}% if you have Immolated the target.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - infernal 104536 / 8847
Immolation 80484 0.7% 1.0 0.00sec 2012176 0 Periodic 44.4 39776 79559 45307 13.9% 8.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.21 44.41 0.0000 1.0914 2012176.32 2012176.32 0.00 83024.27 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.2 86.10% 39775.67 34281 41137 39776.88 38994 40745 1520904 1520904 0.00
crit 6.2 13.90% 79558.60 68561 82274 79441.84 0 82274 491272 491272 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24052 0.2% 22.2 1.10sec 27079 24811 Direct 22.2 23788 47557 27079 13.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.21 22.21 0.00 0.00 1.0914 0.0000 601317.23 883993.28 31.98 24810.91 24810.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.13 86.15% 23787.51 20500 24600 23788.35 23233 24384 455079 669009 31.98
crit 3.08 13.85% 47557.09 41000 49200 45813.80 0 49200 146238 214984 30.80
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - doomguard 93750 / 7923
Doom Bolt 93750 0.8% 11.0 2.23sec 213124 95518 Direct 11.0 187133 374483 213135 13.9%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.00 11.00 0.00 0.00 2.2313 0.0000 2343832.10 2343832.10 0.00 95518.47 95518.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.47 86.12% 187132.68 181003 217204 187144.42 181003 217204 1772275 1772275 0.00
crit 1.53 13.88% 374482.81 362007 434408 301919.10 0 434408 571557 571557 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 104577 / 8849
Immolation 80498 0.7% 1.0 0.00sec 2012521 0 Periodic 44.4 39774 79579 45315 13.9% 8.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.21 44.41 0.0000 1.0914 2012521.22 2012521.22 0.00 83038.51 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.2 86.08% 39774.03 34281 41137 39775.37 39120 40721 1520559 1520559 0.00
crit 6.2 13.92% 79578.79 68561 82274 79462.00 0 82274 491962 491962 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24080 0.2% 22.2 1.10sec 27111 24840 Direct 22.2 23786 47580 27111 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.21 22.21 0.00 0.00 1.0914 0.0000 602019.21 885025.27 31.98 24839.88 24839.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.10 86.03% 23785.64 20500 24600 23786.32 23023 24600 454377 667977 31.98
crit 3.10 13.97% 47580.25 41000 49200 46001.22 0 49200 147642 217048 30.92
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 104624 / 8854
Immolation 80542 0.7% 1.0 0.00sec 2013631 0 Periodic 44.4 39774 79573 45340 14.0% 8.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.21 44.41 0.0000 1.0914 2013631.34 2013631.34 0.00 83084.31 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.2 86.02% 39774.46 34281 41137 39775.62 38994 40581 1519449 1519449 0.00
crit 6.2 13.98% 79573.36 68561 82274 79499.41 0 82274 494182 494182 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24082 0.2% 22.2 1.10sec 27113 24842 Direct 22.2 23786 47582 27113 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.21 22.21 0.00 0.00 1.0914 0.0000 602070.88 885101.22 31.98 24842.01 24842.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.10 86.02% 23785.53 20500 24600 23786.41 23153 24600 454325 667901 31.98
crit 3.11 13.98% 47581.62 41000 49200 45967.62 0 49200 147746 217200 30.88
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lord_of_flames_infernal 104584 / 8850
Immolation 80498 0.7% 1.0 0.00sec 2012530 0 Periodic 44.4 39776 79553 45315 13.9% 8.0%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 22.21 44.41 0.0000 1.0914 2012530.13 2012530.13 0.00 83038.87 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.2 86.08% 39776.10 34281 41137 39777.37 38972 40708 1520551 1520551 0.00
crit 6.2 13.92% 79553.24 68561 82274 79436.63 0 82274 491980 491980 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 24086 0.2% 22.2 1.10sec 27118 24847 Direct 22.2 23787 47568 27118 14.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.21 22.21 0.00 0.00 1.0914 0.0000 602181.18 885263.38 31.98 24846.56 24846.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.10 85.99% 23786.61 20500 24600 23787.63 23023 24600 454215 667739 31.98
crit 3.11 14.01% 47568.24 41000 49200 45883.21 0 49200 147966 217524 30.83
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 111276 / 18946
Shadow Bolt 111276 2.0% 4.4 60.20sec 1293579 0 Periodic 46.5 107097 214092 122015 13.9% 19.8%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.39 0.00 46.75 46.50 0.0000 1.2759 5673437.41 5673437.41 0.00 95120.08 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.0 86.06% 107096.64 69 126576 106950.08 0 126576 4285467 4285467 0.00
crit 6.5 13.94% 214092.31 219 253152 210397.04 0 253152 1387971 1387971 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 133456 / 9123
Chaos Bolt 133456 1.0% 4.3 59.70sec 631483 307332 Direct 4.3 0 635550 635550 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 4.30 0.00 0.00 2.0548 0.0000 2733414.89 2733414.89 0.00 307332.46 307332.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 4.30 100.00% 635549.50 600929 721115 636054.74 0 721115 2733415 2733415 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 226120 / 16912
Chaos Barrage 226120 1.8% 4.4 59.69sec 1158943 0 Periodic 145.4 30518 61072 34788 14.0% 7.9%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 0.00 146.19 145.42 0.0000 0.1621 5058692.82 5058692.82 0.00 213464.97 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.1 86.03% 30518.41 152 34809 30483.31 0 34809 3817682 3817682 0.00
crit 20.3 13.97% 61072.25 304 69619 60973.40 0 69619 1241010 1241010 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Warlock_Destruction_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warlock_Destruction_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.82sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.0 23.56sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.02 0.00 0.00 0.00 0.9952 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:chaos
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warlock_Destruction_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warlock_Destruction_T19M
  • harmful:false
  • if_expr:
 
Havoc 15.1 20.67sec

Stats details: havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.05 0.00 0.00 0.00 1.0563 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: havoc

Static Values
  • id:80240
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:88000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&active_enemies<6&!debuff.havoc.remains
Spelldata
  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
 
Life Tap 15.3 20.45sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.25 0.00 0.00 0.00 0.9902 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Grimoire: Imp (service_imp) 3.7 92.08sec

Stats details: service_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.66 0.00 0.00 0.00 0.9627 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: service_imp

Static Values
  • id:111859
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:111859
  • name:Grimoire: Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp who attacks the target for {$108501s1=25} sec. Imps cast ranged Firebolts and cleanse a hostile magic effect from their master.
 
Soul Harvest 2.9 120.95sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.0679 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.$?s74434[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstant cast.|r][]
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7540 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 20.1 0.0 15.4sec 15.4sec 78.51% 78.51% 1.4(1.4) 19.3

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:734.41

Stack Uptimes

  • accelerando_1:29.78%
  • accelerando_2:24.64%
  • accelerando_3:14.67%
  • accelerando_4:6.53%
  • accelerando_5:2.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.1 0.0 180.8sec 180.8sec 6.84% 7.42% 0.0(0.0) 2.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 12.62% 0.0(0.0) 1.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Conflagration of Chaos 24.3 0.0 12.2sec 12.2sec 49.13% 47.44% 0.0(0.0) 0.7

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:49.13%

Trigger Attempt Success

  • trigger_pct:49.87%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Devil's Due 3.5 0.0 69.5sec 69.5sec 8.71% 8.71% 0.0(0.0) 3.2

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • devils_due_1:8.71%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=7}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Embrace Chaos 26.1 33.0 11.7sec 5.0sec 59.65% 67.41% 33.0(33.0) 25.5

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:59.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Empowered Life Tap 7.3 7.9 41.7sec 20.4sec 97.91% 96.32% 49.5(49.5) 6.4

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_empowered_life_tap
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • empowered_life_tap_1:97.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:235156
  • name:Empowered Life Tap
  • tooltip:Damage increased by {$s1=10}%.
  • description:Damage increased by {$s1=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 97.91% 97.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:97.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.9sec 69.1sec 13.57% 13.57% 0.0(0.0) 3.3

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nefarious_pact_1:13.57%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=20}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=20}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=7}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 127.8sec 0.0sec 19.63% 19.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Soul Harvest 2.9 0.0 120.9sec 120.9sec 17.77% 17.77% 0.0(0.0) 2.7

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • soul_harvest_1:17.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=15 seconds}, increased by {$s2=2} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=35} sec.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 4.4 59.4sec
chaos_tear 4.3 59.6sec
chaos_portal 4.3 59.9sec
dimension_ripper 3.9 55.0sec

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Destruction_T19M
chaos_bolt Soul Shard 59.1 118.2 2.0 2.0 738493.2
havoc Mana 15.1 1324627.4 88000.0 87999.9 0.0
immolate Mana 20.0 1323193.4 66000.0 66000.9 55.4
incinerate Mana 77.7 5128410.5 66000.0 65999.8 7.4
service_imp Soul Shard 3.7 3.7 1.0 1.0 0.0
summon_doomguard Soul Shard 1.0 1.0 1.0 1.0 0.0
summon_infernal Soul Shard 1.0 1.0 1.0 1.0 0.0
pet - imp
firebolt Energy 109.7 4386.0 40.0 40.0 2829.4
pet - service_imp
firebolt Energy 49.2 1969.5 40.0 40.0 5757.1
pet - doomguard
doom_bolt Energy 11.0 384.9 35.0 35.0 6089.3
Resource Gains Type Count Total Average Overflow
life_tap Mana 15.25 3626125.52 (47.45%) 237776.77 1406415.72 27.95%
immolate Soul Shard 65.70 64.99 (53.02%) 0.99 0.71 1.08%
conflagrate Soul Shard 48.80 48.73 (39.75%) 1.00 0.07 0.15%
mp5_regen Mana 485.26 4016300.57 (52.55%) 8276.52 653062.56 13.99%
soulsnatcher Soul Shard 8.86 8.86 (7.22%) 1.00 0.00 0.00%
pet - imp
energy_regen Energy 1870.91 4220.10 (100.00%) 2.26 22.82 0.54%
pet - service_imp
energy_regen Energy 427.65 1355.04 (100.00%) 3.17 63.74 4.49%
pet - doomguard
energy_regen Energy 11.00 349.83 (100.00%) 31.81 45.58 11.53%
Resource RPS-Gain RPS-Loss
Health 0.00 15761.44
Mana 25380.49 25824.84
Soul Shard 0.41 0.41
Combat End Resource Mean Min Max
Mana 965512.32 492053.52 1100000.00
Soul Shard 1.75 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 13.0%

Statistics & Data Analysis

Fight Length
Sample Data Warlock_Destruction_T19M Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Warlock_Destruction_T19M Damage Per Second
Count 9999
Mean 956923.86
Minimum 859351.02
Maximum 1098837.53
Spread ( max - min ) 239486.51
Range [ ( max - min ) / 2 * 100% ] 12.51%
Standard Deviation 31233.6804
5th Percentile 907991.11
95th Percentile 1010437.76
( 95th Percentile - 5th Percentile ) 102446.65
Mean Distribution
Standard Deviation 312.3524
95.00% Confidence Intervall ( 956311.66 - 957536.06 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4093
0.1 Scale Factor Error with Delta=300 8327795
0.05 Scale Factor Error with Delta=300 33311178
0.01 Scale Factor Error with Delta=300 832779436
Priority Target DPS
Sample Data Warlock_Destruction_T19M Priority Target Damage Per Second
Count 9999
Mean 554254.35
Minimum 491642.98
Maximum 630755.13
Spread ( max - min ) 139112.15
Range [ ( max - min ) / 2 * 100% ] 12.55%
Standard Deviation 18734.8316
5th Percentile 524752.50
95th Percentile 586667.06
( 95th Percentile - 5th Percentile ) 61914.56
Mean Distribution
Standard Deviation 187.3577
95.00% Confidence Intervall ( 553887.14 - 554621.57 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4390
0.1 Scale Factor Error with Delta=300 2996286
0.05 Scale Factor Error with Delta=300 11985144
0.01 Scale Factor Error with Delta=300 299628594
DPS(e)
Sample Data Warlock_Destruction_T19M Damage Per Second (Effective)
Count 9999
Mean 956923.86
Minimum 859351.02
Maximum 1098837.53
Spread ( max - min ) 239486.51
Range [ ( max - min ) / 2 * 100% ] 12.51%
Damage
Sample Data Warlock_Destruction_T19M Damage
Count 9999
Mean 237478283.24
Minimum 170572367.32
Maximum 317436044.65
Spread ( max - min ) 146863677.33
Range [ ( max - min ) / 2 * 100% ] 30.92%
DTPS
Sample Data Warlock_Destruction_T19M Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Warlock_Destruction_T19M Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Warlock_Destruction_T19M Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Warlock_Destruction_T19M Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Warlock_Destruction_T19M Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Warlock_Destruction_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Warlock_Destruction_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Warlock_Destruction_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=deadly_grace
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
C 15.05 havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
D 1.00 dimensional_rift,if=charges=3
E 10.21 immolate,if=remains<=tick_time
F 0.59 immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
G 9.29 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
H 2.06 berserking
0.00 blood_fury
0.00 arcane_torrent
I 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
J 13.90 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
K 34.90 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
L 14.25 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
M 3.66 service_pet
N 1.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
O 1.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
P 2.89 soul_harvest
0.00 channel_demonfire,if=dot.immolate.remains>cast_time
0.00 havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
0.00 rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
Q 12.02 dimensional_rift
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
R 58.39 chaos_bolt
0.00 shadowburn
0.00 conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
0.00 immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
S 78.03 incinerate
0.00 life_tap

Sample Sequence

01269ABCDEGHJKMNKPQQRKRSKRSRSKRLCSRSSERSSSRGJKKRRSKLSCSKRQRSSSERSQLSCGJRKRKRKRSSKLSRCRESSRQSSSGJKKLMRCSKRRSQSSSKRSSELSSCSPISSSGJRKQRKKLRSCKQRRSESSSRLSSGCJRRRJRKFRKLQRHRRCSESSSGJKKMRKLSQSCRKRSSSESSSLSSGJCKQRKRKORSKLRSSPSCESSSQSSGJLRRRKKRRCKRQSSSKRRSEJLRMJCRSSRSJSRSS

Sample Sequence Table

time name target resources buffs
Pre flask Warlock_Destruction_T19M 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre food Warlock_Destruction_T19M 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre summon_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre augmentation Warlock_Destruction_T19M 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre life_tap Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, potion_of_deadly_grace
0:00.000 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:00.000 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.103 dimensional_rift Fluffy_Pillow 1032938.8/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:01.975 immolate Fluffy_Pillow 1049492.5/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:02.848 immolate Fluffy_Pillow 1000065.1/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.722 berserking Fluffy_Pillow 950656.7/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:03.722 conflagrate Fluffy_Pillow 950656.7/1100000: 86% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, embrace_chaos, accelerando, potion_of_deadly_grace
0:04.482 conflagrate Fluffy_Pillow 967248.3/1100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando, potion_of_deadly_grace
0:05.242 service_imp Fluffy_Pillow 983839.9/1100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando, potion_of_deadly_grace
0:06.001 summon_infernal Fluffy_Pillow 1000409.7/1100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, conflagration_of_chaos, accelerando, potion_of_deadly_grace
0:06.760 conflagrate Fluffy_Pillow 1016979.5/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
0:07.508 soul_harvest Fluffy_Pillow 1033550.2/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:07.508 dimensional_rift Fluffy_Pillow 1033550.2/1100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:08.263 dimensional_rift Fluffy_Pillow 1050276.0/1100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:09.020 chaos_bolt Fluffy_Pillow 1067046.2/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2), potion_of_deadly_grace
0:10.513 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:11.268 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:12.166 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:13.077 conflagrate Fluffy_Pillow 1034109.2/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, berserking, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:13.853 chaos_bolt Fluffy_Pillow 1050677.0/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:14.901 incinerate Fluffy_Pillow 1070571.8/1100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:15.950 chaos_bolt Fluffy_Pillow 1024485.5/1100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:16.998 incinerate Fluffy_Pillow 1044380.3/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:18.048 conflagrate Fluffy_Pillow 998313.0/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
0:18.914 chaos_bolt Fluffy_Pillow 1014849.4/1100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
0:19.946 life_tap Fluffy_Pillow 1034731.1/1100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:20.796 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:21.644 incinerate Fluffy_Pillow 1028573.1/1100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(3), potion_of_deadly_grace
0:22.663 chaos_bolt Fluffy_Pillow 982675.9/1100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:23.666 incinerate Fluffy_Pillow 1002559.4/1100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(4), potion_of_deadly_grace
0:24.667 incinerate Fluffy_Pillow 955735.5/1100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, potion_of_deadly_grace
0:25.730 immolate Fluffy_Pillow 909731.3/1100000: 83% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:26.603 chaos_bolt Fluffy_Pillow 860304.0/1100000: 78% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:27.650 incinerate Fluffy_Pillow 880179.7/1100000: 80% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
0:28.698 incinerate Fluffy_Pillow 834074.5/1100000: 76% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:29.747 incinerate Fluffy_Pillow 787988.2/1100000: 72% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:30.794 chaos_bolt Fluffy_Pillow 741864.0/1100000: 67% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:31.841 immolate Fluffy_Pillow 761739.7/1100000: 69% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:32.715 conflagrate Fluffy_Pillow 712331.3/1100000: 65% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:33.589 conflagrate Fluffy_Pillow 728922.9/1100000: 66% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:34.462 conflagrate Fluffy_Pillow 745495.6/1100000: 68% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:35.335 chaos_bolt Fluffy_Pillow 762068.2/1100000: 69% mana | 3.0/5: 60% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
0:36.380 chaos_bolt Fluffy_Pillow 782076.1/1100000: 71% mana | 2.0/5: 40% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
0:37.410 incinerate Fluffy_Pillow 801869.1/1100000: 73% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:38.472 conflagrate Fluffy_Pillow 755732.4/1100000: 69% mana | 0.0/5: 0% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:39.360 life_tap Fluffy_Pillow 772341.2/1100000: 70% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:40.245 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, empowered_life_tap, lord_of_flames, embrace_chaos
0:41.307 havoc enemy2 1034057.5/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
0:42.459 incinerate Fluffy_Pillow 962631.8/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
0:43.840 conflagrate Fluffy_Pillow 916500.9/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
0:45.206 chaos_bolt Fluffy_Pillow 936154.1/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
0:47.503 dimensional_rift Fluffy_Pillow 969202.8/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:48.635 chaos_bolt Fluffy_Pillow 985733.1/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:49.994 incinerate Fluffy_Pillow 1005578.2/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
0:51.354 incinerate Fluffy_Pillow 959696.2/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:52.697 incinerate Fluffy_Pillow 913597.2/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
0:54.038 immolate Fluffy_Pillow 867468.6/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
0:55.156 chaos_bolt Fluffy_Pillow 818035.4/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
0:57.387 incinerate Fluffy_Pillow 851371.1/1100000: 77% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:58.689 dimensional_rift Fluffy_Pillow 805225.6/1100000: 73% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
0:59.791 life_tap Fluffy_Pillow 821778.6/1100000: 75% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:00.942 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:02.326 havoc enemy2 1034115.1/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:03.476 immolate Fluffy_Pillow 962660.6/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
1:04.627 conflagrate Fluffy_Pillow 913221.6/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando
1:05.762 chaos_bolt Fluffy_Pillow 929795.7/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
1:08.024 conflagrate Fluffy_Pillow 962827.1/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
1:09.157 chaos_bolt Fluffy_Pillow 979371.9/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:10.516 conflagrate Fluffy_Pillow 999217.9/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:11.633 chaos_bolt Fluffy_Pillow 1015770.0/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:12.976 conflagrate Fluffy_Pillow 1035917.3/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
1:14.078 chaos_bolt Fluffy_Pillow 1052484.3/1100000: 96% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:15.399 incinerate Fluffy_Pillow 1072343.7/1100000: 97% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
1:16.721 incinerate Fluffy_Pillow 1026233.8/1100000: 93% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:18.102 conflagrate Fluffy_Pillow 980102.8/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:19.296 life_tap Fluffy_Pillow 997281.4/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:20.448 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
1:21.829 chaos_bolt Fluffy_Pillow 1034071.9/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
1:24.126 havoc enemy2 1067119.8/1100000: 97% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:25.276 chaos_bolt Fluffy_Pillow 995665.4/1100000: 91% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
1:26.655 immolate Fluffy_Pillow 1015798.2/1100000: 92% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:27.788 incinerate Fluffy_Pillow 966343.1/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
1:29.148 incinerate Fluffy_Pillow 920203.9/1100000: 84% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:30.490 chaos_bolt Fluffy_Pillow 874090.0/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:31.829 dimensional_rift Fluffy_Pillow 893931.8/1100000: 81% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:32.947 incinerate Fluffy_Pillow 910498.7/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:34.287 incinerate Fluffy_Pillow 864355.2/1100000: 79% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:35.628 incinerate Fluffy_Pillow 818226.6/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
1:36.970 immolate Fluffy_Pillow 772115.1/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
1:38.107 conflagrate Fluffy_Pillow 722684.3/1100000: 66% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames
1:39.258 conflagrate Fluffy_Pillow 739244.2/1100000: 67% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames
1:40.409 conflagrate Fluffy_Pillow 755804.1/1100000: 69% mana | 2.0/5: 40% soul_shard lord_of_flames
1:41.558 life_tap Fluffy_Pillow 772335.2/1100000: 70% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, nefarious_pact
1:42.316 service_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact
1:43.069 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando
1:44.559 havoc enemy2 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:45.315 incinerate Fluffy_Pillow 1023039.7/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando
1:46.210 conflagrate Fluffy_Pillow 970159.3/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(2)
1:46.959 chaos_bolt Fluffy_Pillow 981311.9/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:47.827 chaos_bolt Fluffy_Pillow 994361.0/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(3)
1:48.696 incinerate Fluffy_Pillow 1007426.1/1100000: 92% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
1:49.554 dimensional_rift Fluffy_Pillow 954510.0/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
1:50.308 incinerate Fluffy_Pillow 966007.9/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
1:51.165 incinerate Fluffy_Pillow 913076.5/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
1:52.022 incinerate Fluffy_Pillow 860145.1/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, nefarious_pact, accelerando(4)
1:52.880 conflagrate Fluffy_Pillow 807228.9/1100000: 73% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, nefarious_pact, accelerando(4)
1:53.636 chaos_bolt Fluffy_Pillow 818757.3/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando(4)
1:56.191 incinerate Fluffy_Pillow 856917.4/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:57.818 incinerate Fluffy_Pillow 814325.8/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
1:59.444 immolate Fluffy_Pillow 771719.7/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, devils_due
2:00.800 life_tap Fluffy_Pillow 725442.6/1100000: 66% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, devils_due, accelerando
2:02.137 incinerate Fluffy_Pillow 1074966.4/1100000: 98% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:03.497 incinerate Fluffy_Pillow 1028826.1/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando
2:04.858 havoc enemy2 982945.8/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:05.961 incinerate Fluffy_Pillow 911527.9/1100000: 83% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:07.282 soul_harvest Fluffy_Pillow 865387.3/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:07.508 potion Fluffy_Pillow 868784.9/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
2:07.508 incinerate Fluffy_Pillow 868784.9/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3), potion_of_deadly_grace
2:08.828 incinerate Fluffy_Pillow 822776.8/1100000: 75% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5), potion_of_deadly_grace
2:10.112 incinerate Fluffy_Pillow 776633.2/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5), potion_of_deadly_grace
2:11.397 immolate Fluffy_Pillow 730505.2/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(5), potion_of_deadly_grace
2:12.516 conflagrate Fluffy_Pillow 681047.4/1100000: 62% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:13.665 chaos_bolt Fluffy_Pillow 697578.5/1100000: 63% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, potion_of_deadly_grace
2:15.961 conflagrate Fluffy_Pillow 730868.9/1100000: 66% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:17.097 dimensional_rift Fluffy_Pillow 747457.6/1100000: 68% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:18.228 chaos_bolt Fluffy_Pillow 763973.2/1100000: 69% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando, potion_of_deadly_grace
2:19.587 conflagrate Fluffy_Pillow 783882.8/1100000: 71% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:20.705 conflagrate Fluffy_Pillow 800449.7/1100000: 73% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:21.824 life_tap Fluffy_Pillow 817031.4/1100000: 74% mana | 3.0/5: 60% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:22.942 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:24.282 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:25.621 havoc enemy2 1034044.5/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:26.737 conflagrate Fluffy_Pillow 962581.7/1100000: 88% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2), potion_of_deadly_grace
2:27.887 dimensional_rift Fluffy_Pillow 979140.6/1100000: 89% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:29.022 chaos_bolt Fluffy_Pillow 995714.7/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando, potion_of_deadly_grace
2:31.283 chaos_bolt Fluffy_Pillow 1028731.4/1100000: 94% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:32.642 incinerate Fluffy_Pillow 1048576.5/1100000: 95% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:34.001 immolate Fluffy_Pillow 1002421.6/1100000: 91% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:35.135 incinerate Fluffy_Pillow 952981.1/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:36.494 incinerate Fluffy_Pillow 906826.2/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando, potion_of_deadly_grace
2:37.854 incinerate Fluffy_Pillow 860687.0/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:39.195 chaos_bolt Fluffy_Pillow 814558.3/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
2:41.425 life_tap Fluffy_Pillow 846940.5/1100000: 77% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:42.575 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:43.955 incinerate Fluffy_Pillow 1034057.5/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:45.337 immolate Fluffy_Pillow 987941.0/1100000: 90% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:46.489 havoc enemy2 938515.3/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
2:47.641 conflagrate Fluffy_Pillow 867089.6/1100000: 79% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
2:48.791 chaos_bolt Fluffy_Pillow 883635.1/1100000: 80% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
2:51.089 chaos_bolt Fluffy_Pillow 917035.2/1100000: 83% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:52.449 chaos_bolt Fluffy_Pillow 936894.9/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:53.807 conflagrate Fluffy_Pillow 956725.4/1100000: 87% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
2:54.940 chaos_bolt Fluffy_Pillow 973270.2/1100000: 88% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
2:56.303 conflagrate Fluffy_Pillow 993175.5/1100000: 90% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
2:57.420 immolate enemy2 1009727.5/1100000: 92% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
2:58.538 chaos_bolt Fluffy_Pillow 960295.5/1100000: 87% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(3)
2:59.859 conflagrate Fluffy_Pillow 980155.8/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:00.946 life_tap Fluffy_Pillow 996731.7/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
3:02.064 dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:03.215 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos
3:04.592 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:04.592 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:05.774 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:06.959 havoc enemy2 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:07.931 incinerate Fluffy_Pillow 1028563.9/1100000: 94% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:09.096 immolate Fluffy_Pillow 982416.8/1100000: 89% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:10.070 incinerate Fluffy_Pillow 933061.1/1100000: 85% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:11.219 incinerate Fluffy_Pillow 886925.7/1100000: 81% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando(3)
3:12.368 incinerate Fluffy_Pillow 840790.4/1100000: 76% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando(3)
3:13.518 immolate Fluffy_Pillow 794672.4/1100000: 72% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando(3)
3:14.476 conflagrate Fluffy_Pillow 745234.9/1100000: 68% mana | 0.0/5: 0% soul_shard berserking, empowered_life_tap, lord_of_flames, accelerando(3)
3:15.560 conflagrate Fluffy_Pillow 761793.0/1100000: 69% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:16.664 conflagrate Fluffy_Pillow 778342.3/1100000: 71% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:17.813 service_imp Fluffy_Pillow 794873.4/1100000: 72% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames
3:18.963 chaos_bolt Fluffy_Pillow 811419.0/1100000: 74% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames
3:21.261 conflagrate Fluffy_Pillow 845104.6/1100000: 77% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:22.363 life_tap Fluffy_Pillow 861671.7/1100000: 78% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
3:23.465 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(3)
3:24.786 dimensional_rift Fluffy_Pillow 1034061.0/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
3:25.873 incinerate Fluffy_Pillow 1050636.9/1100000: 96% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
3:27.175 havoc enemy2 1004491.4/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
3:28.262 chaos_bolt Fluffy_Pillow 933067.3/1100000: 85% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(4)
3:30.430 conflagrate Fluffy_Pillow 966141.0/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(5)
3:31.511 chaos_bolt Fluffy_Pillow 982692.3/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:32.890 incinerate Fluffy_Pillow 1002610.5/1100000: 91% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:34.230 incinerate Fluffy_Pillow 956467.0/1100000: 87% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:35.571 incinerate Fluffy_Pillow 910338.4/1100000: 83% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:36.911 immolate Fluffy_Pillow 864194.9/1100000: 79% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:38.029 incinerate Fluffy_Pillow 814761.8/1100000: 74% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:39.370 incinerate Fluffy_Pillow 768633.2/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(2)
3:40.711 incinerate Fluffy_Pillow 722505.6/1100000: 66% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:42.032 life_tap Fluffy_Pillow 676365.0/1100000: 61% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:43.132 incinerate Fluffy_Pillow 1022902.0/1100000: 93% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:44.455 incinerate Fluffy_Pillow 976791.5/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, accelerando(3)
3:45.776 immolate Fluffy_Pillow 929847.0/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:46.927 conflagrate Fluffy_Pillow 880407.0/1100000: 80% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:48.077 havoc enemy2 896952.5/1100000: 82% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:49.227 conflagrate Fluffy_Pillow 825498.0/1100000: 75% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos
3:50.360 dimensional_rift Fluffy_Pillow 842042.9/1100000: 77% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:51.492 chaos_bolt Fluffy_Pillow 858573.2/1100000: 78% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando
3:53.755 conflagrate Fluffy_Pillow 891619.1/1100000: 81% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:54.889 chaos_bolt Fluffy_Pillow 908178.6/1100000: 83% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando
3:56.249 conflagrate Fluffy_Pillow 928084.7/1100000: 84% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(2)
3:57.367 summon_doomguard Fluffy_Pillow 944651.5/1100000: 86% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(2)
3:58.478 chaos_bolt Fluffy_Pillow 961201.5/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
3:59.782 incinerate Fluffy_Pillow 981086.5/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:01.085 conflagrate Fluffy_Pillow 934956.2/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando(4)
4:02.227 life_tap Fluffy_Pillow 951509.1/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:03.379 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:04.758 incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:06.138 incinerate Fluffy_Pillow 1034057.5/1100000: 94% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:07.517 soul_harvest Fluffy_Pillow 987958.3/1100000: 90% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:07.517 incinerate Fluffy_Pillow 987958.3/1100000: 90% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos, accelerando
4:08.877 havoc enemy2 941818.0/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
4:10.011 immolate Fluffy_Pillow 870377.5/1100000: 79% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando
4:11.143 incinerate Fluffy_Pillow 821084.8/1100000: 75% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:12.485 incinerate Fluffy_Pillow 774970.9/1100000: 70% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:13.826 incinerate Fluffy_Pillow 728842.3/1100000: 66% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:15.168 dimensional_rift Fluffy_Pillow 682728.5/1100000: 62% mana | 0.0/5: 0% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:16.286 incinerate Fluffy_Pillow 699295.4/1100000: 64% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(2)
4:17.625 incinerate Fluffy_Pillow 653137.8/1100000: 59% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:18.945 immolate Fluffy_Pillow 606982.1/1100000: 55% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos, accelerando(3)
4:20.082 conflagrate Fluffy_Pillow 557528.7/1100000: 51% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, conflagration_of_chaos
4:21.233 life_tap Fluffy_Pillow 574088.6/1100000: 52% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames
4:22.383 chaos_bolt Fluffy_Pillow 920634.1/1100000: 84% mana | 5.0/5: 100% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, nefarious_pact
4:23.895 chaos_bolt Fluffy_Pillow 942405.5/1100000: 86% mana | 4.0/5: 80% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:24.791 chaos_bolt Fluffy_Pillow 955490.7/1100000: 87% mana | 3.0/5: 60% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:25.674 conflagrate Fluffy_Pillow 968575.2/1100000: 88% mana | 1.0/5: 20% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:26.429 conflagrate Fluffy_Pillow 979763.1/1100000: 89% mana | 2.0/5: 40% soul_shard empowered_life_tap, soul_harvest, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:27.184 chaos_bolt Fluffy_Pillow 990950.9/1100000: 90% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:28.066 chaos_bolt Fluffy_Pillow 1004020.7/1100000: 91% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:28.948 havoc enemy2 1017091.5/1100000: 92% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:29.702 conflagrate Fluffy_Pillow 940426.8/1100000: 85% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:30.447 chaos_bolt Fluffy_Pillow 951787.5/1100000: 87% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:31.304 dimensional_rift Fluffy_Pillow 964856.1/1100000: 88% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:32.058 incinerate Fluffy_Pillow 976354.0/1100000: 89% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(4)
4:32.916 incinerate Fluffy_Pillow 923516.0/1100000: 84% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:33.762 incinerate Fluffy_Pillow 870599.0/1100000: 79% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:34.607 conflagrate Fluffy_Pillow 817666.5/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando(5)
4:35.874 chaos_bolt Fluffy_Pillow 837194.4/1100000: 76% mana | 4.0/5: 80% soul_shard empowered_life_tap, lord_of_flames, devils_due
4:38.581 chaos_bolt Fluffy_Pillow 876141.1/1100000: 80% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
4:40.206 incinerate Fluffy_Pillow 899520.7/1100000: 82% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due
4:41.832 immolate Fluffy_Pillow 856915.7/1100000: 78% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, devils_due, accelerando
4:43.169 conflagrate Fluffy_Pillow 810560.0/1100000: 74% mana | 1.0/5: 20% soul_shard lord_of_flames, embrace_chaos, accelerando(3)
4:44.271 life_tap Fluffy_Pillow 827127.1/1100000: 75% mana | 3.0/5: 60% soul_shard lord_of_flames, accelerando(3)
4:45.373 chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard empowered_life_tap, lord_of_flames, accelerando(3)
4:47.573 service_imp Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
4:48.899 conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, accelerando(4)
4:49.983 havoc enemy2 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:50.737 chaos_bolt Fluffy_Pillow 1023660.3/1100000: 93% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:51.583 incinerate Fluffy_Pillow 1036743.3/1100000: 94% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:52.427 incinerate Fluffy_Pillow 983795.3/1100000: 89% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:53.272 chaos_bolt Fluffy_Pillow 930862.9/1100000: 85% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(5)
4:54.119 incinerate Fluffy_Pillow 943648.1/1100000: 86% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando
4:55.016 conflagrate Fluffy_Pillow 890748.0/1100000: 81% mana | 0.0/5: 0% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(2)
4:55.768 incinerate Fluffy_Pillow 901915.5/1100000: 82% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:56.639 chaos_bolt Fluffy_Pillow 849009.8/1100000: 77% mana | 2.0/5: 40% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:57.508 incinerate Fluffy_Pillow 862074.0/1100000: 78% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)
4:58.379 incinerate Fluffy_Pillow 809168.3/1100000: 74% mana | 1.0/5: 20% soul_shard empowered_life_tap, lord_of_flames, embrace_chaos, nefarious_pact, accelerando(3)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 51868 51868 33640
Intellect 49775 48068 38456 (1278)
Spirit 1 1 0
Health 3112080 3112080 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 49775 48068 0
Crit 13.94% 13.94% 3577
Haste 30.79% 29.79% 11173
Damage / Heal Versatility 5.96% 5.96% 2829
ManaReg per Second 14387 14277 0
Mastery 67.65% 67.65% 5819
Armor 1954 1954 1954
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 905.00
Local Head Eyes of Azj'Aqir
ilevel: 900, stats: { 253 Armor, +3255 Sta, +2170 Int, +1074 Haste, +578 Vers }
Local Neck Radiant String of Scorpid Eyes
ilevel: 900, stats: { +1831 Sta, +2011 Haste, +922 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 900, stats: { 233 Armor, +2442 Sta, +1628 Int, +752 Mastery, +487 Vers }
Local Chest Robes of Fluctuating Energy
ilevel: 900, stats: { 311 Armor, +3255 Sta, +2170 Int, +1145 Haste, +507 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 900, stats: { 175 Armor, +2442 Sta, +1628 Int, +699 Haste, +540 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 900, stats: { 272 Armor, +3255 Sta, +2170 Int, +932 Crit, +720 Haste }
Local Feet Outcast Wanderer's Footrags
ilevel: 910, stats: { 222 Armor, +2680 Sta, +1786 Int, +864 Crit, +422 Mastery }
Local Wrists Woven Lasher Tendril Bracers
ilevel: 900, stats: { 136 Armor, +1831 Sta, +1221 Int, +644 Haste, +285 Vers }
Local Hands Clutch of Azj'Aqir
ilevel: 900, stats: { 194 Armor, +2442 Sta, +1628 Int, +859 Crit, +380 Mastery }
Local Finger1 Ring of the Scoured Clan
ilevel: 915, stats: { +2106 Sta, +2296 Mastery, +918 Haste }, gems: { +150 Haste }, enchant: { +200 Haste }
Local Finger2 Ring of Braided Stems
ilevel: 905, stats: { +1918 Sta, +1814 Haste, +1209 Vers }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 905, stats: { +2162 Int }
Local Trinket2 Erratic Metronome
ilevel: 900, stats: { +2063 Int }
Local Back Astromancer's Greatcloak
ilevel: 905, stats: { 158 Armor, +1918 Sta, +1278 StrAgiInt, +676 Haste, +270 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 929, weapon: { 7005 - 10509, 3.6 }, stats: { +2843 Int, +4265 Sta, +922 Haste, +922 Mastery, +15509 Int }, relics: { +61 ilevels, +59 ilevels, +61 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="Warlock_Destruction_T19M"
level=110
race=troll
role=spell
position=back
talents=2303021
artifact=38:142513:142516:142513:0:803:1:804:3:805:3:806:5:807:3:808:3:809:4:810:3:811:3:812:3:813:1:814:1:815:1:816:1:817:1:818:1:1355:1
spec=destruction

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>=3
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies<3&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=havoc,target=2,if=active_enemies>1&active_enemies<6&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/immolate,if=remains<=tick_time
actions+=/immolate,cycle_targets=1,if=active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/arcane_torrent
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains&(charges=1&recharge_time<action.chaos_bolt.cast_time|charges=2)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<3&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>=3
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>=3&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions+=/havoc,if=active_enemies=1&talent.wreak_havoc.enabled&equipped.132375&!debuff.havoc.remains
actions+=/rain_of_fire,if=active_enemies>=4&cooldown.havoc.remains<=12&!talent.wreak_havoc.enabled
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&!buff.backdraft.remains
actions+=/immolate,if=!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=eyes_of_azjaqir,id=138314,bonus_id=3445
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3445,enchant_id=5439
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3445
back=astromancers_greatcloak,id=140909,bonus_id=3518,enchant_id=5436
chest=robes_of_fluctuating_energy,id=140848,bonus_id=3445
wrists=woven_lasher_tendril_bracers,id=140886,bonus_id=3445
hands=clutch_of_azjaqir,id=138311,bonus_id=3445
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3445
legs=leggings_of_azjaqir,id=138317,bonus_id=3445
feet=outcast_wanderers_footrags,id=140914,bonus_id=3519
finger1=ring_of_the_scoured_clan,id=140897,bonus_id=3445/670,gem_id=130220,enchant=binding_of_haste
finger2=ring_of_braided_stems,id=140896,bonus_id=3518,enchant=binding_of_haste
trinket1=whispers_in_the_dark,id=140809,ilevel=905
trinket2=erratic_metronome,id=140792,ilevel=900
main_hand=scepter_of_sargeras,id=128941,ilevel=929,gem_id=140826/140837/140826,relic_id=3519/3518:3518/3519

# Gear Summary
# gear_ilvl=904.60
# gear_stamina=33640
# gear_intellect=38456
# gear_crit_rating=3577
# gear_haste_rating=11173
# gear_mastery_rating=5819
# gear_versatility_rating=2829
# gear_armor=1954
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

Simulation & Raid Information

Iterations: 10003
Threads: 4
Confidence: 95.00%
Fight Length: 224 - 376 ( 301.1 )

Performance:

Total Events Processed: 992599127
Max Event Queue: 1247
Sim Seconds: 3012045
CPU Seconds: 1064.6563
Physical Seconds: 312.1433
Speed Up: 2829

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Alythyss Alythyss augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Alythyss Alythyss berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.96sec 0 301.11sec
Alythyss Alythyss chaos_bolt 116858 88928652 295332 23.12 0 766538 60.1 116.0 100.0% 0.0% 0.0% 0.0% 4.85sec 88928652 301.11sec
Alythyss Alythyss conflagrate 17962 32032964 106381 19.65 183759 426843 49.3 98.6 58.0% 0.0% 0.0% 0.0% 6.09sec 32032964 301.11sec
Alythyss Alythyss deadly_grace 188091 4319443 14345 6.65 108426 216848 33.4 33.4 19.3% 0.0% 0.0% 0.0% 4.95sec 4319443 301.11sec
Alythyss Alythyss dimensional_rift 196586 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.40sec 0 301.11sec
Alythyss Alythyss flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Alythyss Alythyss food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Alythyss Alythyss havoc 80240 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.65sec 0 301.11sec
Alythyss Alythyss immolate 348 7429830 24674 7.79 125540 251176 20.3 39.1 51.3% 0.0% 0.0% 0.0% 14.99sec 72342344 301.11sec
Alythyss Alythyss immolate ticks -348 64912514 216375 60.83 141074 282132 20.3 304.1 51.3% 0.0% 0.0% 0.0% 14.99sec 72342344 301.11sec
Alythyss Alythyss incinerate 29722 37079328 123140 29.93 207073 414088 78.0 150.2 19.2% 0.0% 0.0% 0.0% 3.68sec 37079328 301.11sec
Alythyss Alythyss life_tap 1454 0 0 0.00 0 0 15.3 0.0 0.0% 0.0% 0.0% 0.0% 20.43sec 0 301.11sec
Alythyss Alythyss mark_of_the_hidden_satyr 191259 3045524 10114 4.08 124779 249423 20.5 20.5 19.3% 0.0% 0.0% 0.0% 14.67sec 3045524 301.11sec
Alythyss Alythyss potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Alythyss Alythyss service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 92.04sec 0 301.11sec
Alythyss Alythyss soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.25sec 0 301.11sec
Alythyss Alythyss summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Alythyss Alythyss summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Alythyss Alythyss summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Alythyss Alythyss_imp firebolt 3110 13160567 43706 21.96 100101 200201 111.0 110.2 19.3% 0.0% 0.0% 0.0% 2.71sec 13160567 301.11sec
Alythyss Alythyss_service_imp firebolt 3110 11900501 124382 30.73 203561 407060 49.3 49.0 19.3% 0.0% 0.0% 0.0% 5.52sec 11900501 95.68sec
Alythyss Alythyss_infernal immolation ticks -19483 2164112 7214 4.57 39673 79335 1.0 22.9 19.3% 0.0% 0.0% 0.0% 0.00sec 2164112 25.00sec
Alythyss Alythyss_infernal melee 0 647221 25888 54.89 23725 47441 22.9 22.9 19.3% 0.0% 0.0% 0.0% 1.08sec 951476 25.00sec
Alythyss Alythyss_doomguard doom_bolt 85692 2454299 98168 26.42 187224 374282 11.0 11.0 19.1% 0.0% 0.0% 0.0% 2.20sec 2454299 25.00sec
Alythyss Alythyss_lord_of_flames_infernal immolation ticks -19483 2163826 7213 4.57 39673 79330 1.0 22.9 19.2% 0.0% 0.0% 0.0% 0.00sec 2163826 25.00sec
Alythyss Alythyss_lord_of_flames_infernal melee 0 646717 25868 54.89 23722 47463 22.9 22.9 19.2% 0.0% 0.0% 0.0% 1.08sec 950736 25.00sec
Alythyss Alythyss_lord_of_flames_infernal immolation ticks -19483 2163667 7212 4.57 39674 79321 1.0 22.9 19.2% 0.0% 0.0% 0.0% 0.00sec 2163667 25.00sec
Alythyss Alythyss_lord_of_flames_infernal melee 0 646932 25876 54.89 23728 47417 22.9 22.9 19.2% 0.0% 0.0% 0.0% 1.08sec 951051 25.00sec
Alythyss Alythyss_lord_of_flames_infernal immolation ticks -19483 2164592 7215 4.57 39670 79356 1.0 22.9 19.3% 0.0% 0.0% 0.0% 0.00sec 2164592 25.00sec
Alythyss Alythyss_lord_of_flames_infernal melee 0 647214 25888 54.89 23724 47450 22.9 22.9 19.3% 0.0% 0.0% 0.0% 1.08sec 951466 25.00sec
Alythyss Alythyss_shadowy_tear shadow_bolt ticks -196657 6044809 20149 9.42 108090 216257 4.4 47.1 19.4% 0.0% 0.0% 0.0% 59.37sec 6044809 51.86sec
Alythyss Alythyss_chaos_tear chaos_bolt 215279 2881778 138542 12.50 0 665064 4.4 4.3 100.0% 0.0% 0.0% 0.0% 59.21sec 2881778 20.80sec
Alythyss Alythyss_chaos_portal chaos_barrage ticks -187394 5394940 17983 29.74 30562 61120 4.4 148.7 19.3% 0.0% 0.0% 0.0% 59.01sec 5394940 22.71sec
Burning_Wish/Metronome Burning_Wish/Metronome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.99sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome chaos_bolt 116858 89041620 295707 21.80 0 813810 57.0 109.4 100.0% 0.0% 0.0% 0.0% 5.13sec 89041620 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome conflagrate 17962 33857178 112440 19.56 202473 458294 49.1 98.2 55.7% 0.0% 0.0% 0.0% 6.11sec 33857178 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome deadly_grace 188091 4113673 13662 6.57 108437 216919 33.0 33.0 15.1% 0.0% 0.0% 0.0% 5.00sec 4113673 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome dimensional_rift 196586 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.22sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome havoc 80240 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.67sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome immolate 348 7962631 26444 7.78 138491 276985 20.2 39.0 47.3% 0.0% 0.0% 0.0% 15.06sec 73298664 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome immolate ticks -348 65336033 217787 57.45 154596 309206 20.2 287.3 47.1% 0.0% 0.0% 0.0% 15.06sec 73298664 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome incinerate 29722 35325195 117315 26.79 228305 456575 70.0 134.4 15.1% 0.0% 0.0% 0.0% 4.10sec 35325195 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome kiljaedens_burning_wish 235999 4821492 16012 1.78 0 539100 4.5 8.9 100.0% 0.0% 0.0% 0.0% 75.45sec 4821492 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome life_tap 1454 0 0 0.00 0 0 15.3 0.0 0.0% 0.0% 0.0% 0.0% 20.40sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome mark_of_the_hidden_satyr 191259 2971163 9867 4.05 126950 253867 20.3 20.3 15.2% 0.0% 0.0% 0.0% 14.83sec 2971163 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 92.18sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.09sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome_imp firebolt 3110 12863877 42721 21.87 101852 203673 110.6 109.7 15.1% 0.0% 0.0% 0.0% 2.72sec 12863877 301.11sec
Burning_Wish/Metronome Burning_Wish/Metronome_service_imp firebolt 3110 11654920 121994 30.73 207054 414083 49.2 48.9 15.0% 0.0% 0.0% 0.0% 5.52sec 11654920 95.54sec
Burning_Wish/Metronome Burning_Wish/Metronome_infernal immolation ticks -19483 2108505 7028 4.53 40410 80832 1.0 22.7 15.2% 0.0% 0.0% 0.0% 0.00sec 2108505 25.00sec
Burning_Wish/Metronome Burning_Wish/Metronome_infernal melee 0 628924 25156 54.37 24167 48321 22.7 22.7 14.9% 0.0% 0.0% 0.0% 1.09sec 924578 25.00sec
Burning_Wish/Metronome Burning_Wish/Metronome_doomguard doom_bolt 85692 2411789 96468 26.41 190455 380682 11.0 11.0 15.1% 0.0% 0.0% 0.0% 2.21sec 2411789 25.00sec
Burning_Wish/Metronome Burning_Wish/Metronome_lord_of_flames_infernal immolation ticks -19483 2108792 7029 4.53 40410 80830 1.0 22.7 15.2% 0.0% 0.0% 0.0% 0.00sec 2108792 25.00sec
Burning_Wish/Metronome Burning_Wish/Metronome_lord_of_flames_infernal melee 0 630272 25210 54.37 24166 48325 22.7 22.7 15.1% 0.0% 0.0% 0.0% 1.09sec 926559 25.00sec
Burning_Wish/Metronome Burning_Wish/Metronome_lord_of_flames_infernal immolation ticks -19483 2106382 7021 4.53 40408 80848 1.0 22.7 15.0% 0.0% 0.0% 0.0% 0.00sec 2106382 25.00sec
Burning_Wish/Metronome Burning_Wish/Metronome_lord_of_flames_infernal melee 0 629875 25194 54.37 24165 48338 22.7 22.7 15.1% 0.0% 0.0% 0.0% 1.09sec 925976 25.00sec
Burning_Wish/Metronome Burning_Wish/Metronome_lord_of_flames_infernal immolation ticks -19483 2105438 7018 4.53 40411 80818 1.0 22.7 15.0% 0.0% 0.0% 0.0% 0.00sec 2105438 25.00sec
Burning_Wish/Metronome Burning_Wish/Metronome_lord_of_flames_infernal melee 0 629610 25183 54.37 24165 48338 22.7 22.7 15.0% 0.0% 0.0% 0.0% 1.09sec 925587 25.00sec
Burning_Wish/Metronome Burning_Wish/Metronome_shadowy_tear shadow_bolt ticks -196657 5748225 19161 9.13 109934 219804 4.3 45.7 15.2% 0.0% 0.0% 0.0% 60.67sec 5748225 50.60sec
Burning_Wish/Metronome Burning_Wish/Metronome_chaos_tear chaos_bolt 215279 2737206 135826 12.48 0 653251 4.2 4.2 100.0% 0.0% 0.0% 0.0% 61.27sec 2737206 20.15sec
Burning_Wish/Metronome Burning_Wish/Metronome_chaos_portal chaos_barrage ticks -187394 5152011 17173 28.93 31088 62186 4.3 144.7 15.1% 0.0% 0.0% 0.0% 61.23sec 5152011 22.22sec
Burning_Wish/Whispers Burning_Wish/Whispers augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.58sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers chaos_bolt 116858 90045662 299042 21.98 0 816282 57.4 110.3 100.0% 0.0% 0.0% 0.0% 5.09sec 90045662 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers conflagrate 17962 32991721 109565 19.21 202396 457253 48.2 96.4 54.9% 0.0% 0.0% 0.0% 6.23sec 32991721 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers deadly_grace 188091 4025793 13370 6.44 108191 216392 32.3 32.3 15.1% 0.0% 0.0% 0.0% 5.10sec 4025793 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers dimensional_rift 196586 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.61sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers havoc 80240 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.68sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers immolate 348 7864907 26119 7.69 138693 277098 19.8 38.6 47.1% 0.0% 0.0% 0.0% 15.41sec 74613798 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers immolate ticks -348 66748892 222496 59.02 153826 307429 19.8 295.1 47.1% 0.0% 0.0% 0.0% 15.41sec 74613798 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers incinerate 29722 38332327 127302 29.02 228677 457470 75.6 145.7 15.1% 0.0% 0.0% 0.0% 3.79sec 38332327 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers kiljaedens_burning_wish 235999 4820413 16009 1.78 0 539100 4.5 8.9 100.0% 0.0% 0.0% 0.0% 75.48sec 4820413 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers life_tap 1454 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.68sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers mark_of_the_hidden_satyr 191259 2904526 9646 3.96 127073 254208 19.9 19.9 15.1% 0.0% 0.0% 0.0% 15.07sec 2904526 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.89sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.30sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers_imp firebolt 3110 12604735 41860 21.37 102123 204269 108.1 107.3 15.1% 0.0% 0.0% 0.0% 2.79sec 12604735 301.11sec
Burning_Wish/Whispers Burning_Wish/Whispers_service_imp firebolt 3110 11683494 122024 30.71 207089 414004 49.3 49.0 15.1% 0.0% 0.0% 0.0% 5.52sec 11683494 95.75sec
Burning_Wish/Whispers Burning_Wish/Whispers_infernal immolation ticks -19483 2044852 6816 4.40 40418 80847 1.0 22.0 15.0% 0.0% 0.0% 0.0% 0.00sec 2044852 25.00sec
Burning_Wish/Whispers Burning_Wish/Whispers_infernal melee 0 611484 24458 52.80 24169 48354 22.0 22.0 15.0% 0.0% 0.0% 0.0% 1.12sec 898939 25.00sec
Burning_Wish/Whispers Burning_Wish/Whispers_doomguard doom_bolt 85692 2414046 96562 26.40 190864 381974 11.0 11.0 15.0% 0.0% 0.0% 0.0% 2.27sec 2414046 25.00sec
Burning_Wish/Whispers Burning_Wish/Whispers_lord_of_flames_infernal immolation ticks -19483 2045470 6818 4.40 40421 80818 1.0 22.0 15.0% 0.0% 0.0% 0.0% 0.00sec 2045470 25.00sec
Burning_Wish/Whispers Burning_Wish/Whispers_lord_of_flames_infernal melee 0 611932 24476 52.80 24171 48331 22.0 22.0 15.1% 0.0% 0.0% 0.0% 1.12sec 899598 25.00sec
Burning_Wish/Whispers Burning_Wish/Whispers_lord_of_flames_infernal immolation ticks -19483 2046807 6823 4.40 40419 80836 1.0 22.0 15.1% 0.0% 0.0% 0.0% 0.00sec 2046807 25.00sec
Burning_Wish/Whispers Burning_Wish/Whispers_lord_of_flames_infernal melee 0 611587 24462 52.80 24174 48305 22.0 22.0 15.0% 0.0% 0.0% 0.0% 1.12sec 899091 25.00sec
Burning_Wish/Whispers Burning_Wish/Whispers_lord_of_flames_infernal immolation ticks -19483 2047439 6825 4.40 40422 80798 1.0 22.0 15.1% 0.0% 0.0% 0.0% 0.00sec 2047439 25.00sec
Burning_Wish/Whispers Burning_Wish/Whispers_lord_of_flames_infernal melee 0 611989 24479 52.80 24170 48346 22.0 22.0 15.1% 0.0% 0.0% 0.0% 1.12sec 899682 25.00sec
Burning_Wish/Whispers Burning_Wish/Whispers_shadowy_tear shadow_bolt ticks -196657 5691458 18972 9.23 107861 215841 4.3 46.1 15.0% 0.0% 0.0% 0.0% 59.91sec 5691458 51.20sec
Burning_Wish/Whispers Burning_Wish/Whispers_chaos_tear chaos_bolt 215279 2833034 136331 12.50 0 654502 4.4 4.3 100.0% 0.0% 0.0% 0.0% 58.78sec 2833034 20.78sec
Burning_Wish/Whispers Burning_Wish/Whispers_chaos_portal chaos_barrage ticks -187394 5106707 17022 28.83 30943 61900 4.3 144.1 15.0% 0.0% 0.0% 0.0% 60.13sec 5106707 22.47sec
Feretory_BD Feretory_BD augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_BD Feretory_BD berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.40sec 0 301.11sec
Feretory_BD Feretory_BD chaos_bolt 116858 104102477 345724 25.91 0 800511 67.3 130.0 100.0% 0.0% 0.0% 0.0% 4.36sec 104102477 301.11sec
Feretory_BD Feretory_BD conflagrate 17962 33575052 111503 19.39 202746 456553 49.0 97.3 56.1% 0.0% 0.0% 0.0% 6.14sec 33575052 301.11sec
Feretory_BD Feretory_BD deadly_grace 188091 3754746 12470 6.65 98714 197427 33.4 33.4 14.0% 0.0% 0.0% 0.0% 4.87sec 3754746 301.11sec
Feretory_BD Feretory_BD dimensional_rift 196586 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.55sec 0 301.11sec
Feretory_BD Feretory_BD flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_BD Feretory_BD food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_BD Feretory_BD havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.91sec 0 301.11sec
Feretory_BD Feretory_BD immolate 348 7031583 23352 6.86 139853 279774 18.0 34.4 46.0% 0.0% 0.0% 0.0% 17.01sec 39912968 301.11sec
Feretory_BD Feretory_BD immolate ticks -348 32881385 109605 59.42 75845 151660 18.0 297.1 46.0% 0.0% 0.0% 0.0% 17.01sec 39912968 301.11sec
Feretory_BD Feretory_BD incinerate 29722 48984863 162679 37.85 226330 452689 99.0 190.0 13.9% 0.0% 0.0% 0.0% 2.97sec 48984863 301.11sec
Feretory_BD Feretory_BD life_tap 1454 0 0 0.00 0 0 10.6 0.0 0.0% 0.0% 0.0% 0.0% 22.81sec 0 301.11sec
Feretory_BD Feretory_BD mark_of_the_hidden_satyr 191259 2667608 8859 4.04 115499 230948 20.3 20.3 13.9% 0.0% 0.0% 0.0% 14.80sec 2667608 301.11sec
Feretory_BD Feretory_BD potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_BD Feretory_BD service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.98sec 0 301.11sec
Feretory_BD Feretory_BD soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.70sec 0 301.11sec
Feretory_BD Feretory_BD summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_BD Feretory_BD summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_BD Feretory_BD summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_BD Feretory_BD_imp firebolt 3110 12667448 42069 21.74 101945 203897 109.9 109.1 13.9% 0.0% 0.0% 0.0% 2.74sec 12667448 301.11sec
Feretory_BD Feretory_BD_service_imp firebolt 3110 11651551 120509 30.69 206751 413570 49.8 49.5 13.9% 0.0% 0.0% 0.0% 5.49sec 11651551 96.69sec
Feretory_BD Feretory_BD_infernal immolation ticks -19483 2079707 6932 4.52 40359 80685 1.0 22.6 14.0% 0.0% 0.0% 0.0% 0.00sec 2079707 25.00sec
Feretory_BD Feretory_BD_infernal melee 0 621775 24870 54.23 24133 48267 22.6 22.6 14.0% 0.0% 0.0% 0.0% 1.09sec 914068 25.00sec
Feretory_BD Feretory_BD_doomguard doom_bolt 85692 2382770 95307 26.40 189954 379836 11.0 11.0 14.0% 0.0% 0.0% 0.0% 2.23sec 2382770 25.00sec
Feretory_BD Feretory_BD_lord_of_flames_infernal immolation ticks -19483 2077533 6925 4.52 40357 80708 1.0 22.6 13.9% 0.0% 0.0% 0.0% 0.00sec 2077533 25.00sec
Feretory_BD Feretory_BD_lord_of_flames_infernal melee 0 621874 24874 54.23 24133 48277 22.6 22.6 14.0% 0.0% 0.0% 0.0% 1.09sec 914213 25.00sec
Feretory_BD Feretory_BD_lord_of_flames_infernal immolation ticks -19483 2076889 6923 4.52 40357 80713 1.0 22.6 13.9% 0.0% 0.0% 0.0% 0.00sec 2076889 25.00sec
Feretory_BD Feretory_BD_lord_of_flames_infernal melee 0 620300 24811 54.23 24135 48248 22.6 22.6 13.7% 0.0% 0.0% 0.0% 1.09sec 911900 25.00sec
Feretory_BD Feretory_BD_lord_of_flames_infernal immolation ticks -19483 2078885 6930 4.52 40358 80700 1.0 22.6 14.0% 0.0% 0.0% 0.0% 0.00sec 2078885 25.00sec
Feretory_BD Feretory_BD_lord_of_flames_infernal melee 0 621636 24864 54.23 24134 48258 22.6 22.6 14.0% 0.0% 0.0% 0.0% 1.09sec 913863 25.00sec
Feretory_BD Feretory_BD_shadowy_tear shadow_bolt ticks -196657 6203917 20680 10.08 108586 217582 4.7 50.4 14.0% 0.0% 0.0% 0.0% 55.38sec 6203917 54.75sec
Feretory_BD Feretory_BD_chaos_tear chaos_bolt 215279 3010556 140551 13.10 0 643587 4.7 4.7 100.0% 0.0% 0.0% 0.0% 56.10sec 3010556 21.42sec
Feretory_BD Feretory_BD_chaos_portal chaos_barrage ticks -187394 5647176 18824 31.96 31168 62339 4.7 159.8 13.9% 0.0% 0.0% 0.0% 56.16sec 5647176 23.42sec
Feretory_RB Feretory_RB augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_RB Feretory_RB berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.67sec 0 301.11sec
Feretory_RB Feretory_RB chaos_bolt 116858 100229080 332861 25.15 0 794063 65.8 126.2 100.0% 0.0% 0.0% 0.0% 4.44sec 100229080 301.11sec
Feretory_RB Feretory_RB conflagrate 17962 32481278 107870 19.35 198554 446495 48.9 97.1 54.8% 0.0% 0.0% 0.0% 6.15sec 32481278 301.11sec
Feretory_RB Feretory_RB deadly_grace 188091 3722468 12362 6.60 98672 197278 33.1 33.1 14.0% 0.0% 0.0% 0.0% 4.96sec 3722468 301.11sec
Feretory_RB Feretory_RB dimensional_rift 196586 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.56sec 0 301.11sec
Feretory_RB Feretory_RB flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_RB Feretory_RB food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_RB Feretory_RB havoc 80240 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 20.88sec 0 301.11sec
Feretory_RB Feretory_RB immolate 348 7755835 25757 7.75 136718 273380 20.2 38.9 45.9% 0.0% 0.0% 0.0% 15.06sec 74646835 301.11sec
Feretory_RB Feretory_RB immolate ticks -348 66891000 222970 60.01 152711 305555 20.2 300.0 45.9% 0.0% 0.0% 0.0% 15.06sec 74646835 301.11sec
Feretory_RB Feretory_RB incinerate 29722 37969746 126098 29.29 226772 453493 77.1 147.0 13.9% 0.0% 0.0% 0.0% 3.72sec 37969746 301.11sec
Feretory_RB Feretory_RB life_tap 1454 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 32.32sec 0 301.11sec
Feretory_RB Feretory_RB mark_of_the_hidden_satyr 191259 2659765 8833 4.03 115404 230880 20.2 20.2 14.0% 0.0% 0.0% 0.0% 14.84sec 2659765 301.11sec
Feretory_RB Feretory_RB potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_RB Feretory_RB service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.70sec 0 301.11sec
Feretory_RB Feretory_RB soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.82sec 0 301.11sec
Feretory_RB Feretory_RB summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_RB Feretory_RB summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_RB Feretory_RB summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Feretory_RB Feretory_RB_imp firebolt 3110 12628689 41940 21.73 101593 203235 109.9 109.1 14.0% 0.0% 0.0% 0.0% 2.74sec 12628689 301.11sec
Feretory_RB Feretory_RB_service_imp firebolt 3110 11540988 120339 30.72 206169 412486 49.4 49.1 14.0% 0.0% 0.0% 0.0% 5.50sec 11540988 95.90sec
Feretory_RB Feretory_RB_infernal immolation ticks -19483 2056173 6854 4.47 40364 80747 1.0 22.4 13.9% 0.0% 0.0% 0.0% 0.00sec 2056173 25.00sec
Feretory_RB Feretory_RB_infernal melee 0 615007 24599 53.65 24137 48302 22.4 22.4 14.0% 0.0% 0.0% 0.0% 1.09sec 904118 25.00sec
Feretory_RB Feretory_RB_doomguard doom_bolt 85692 2384068 95359 26.40 190042 379979 11.0 11.0 14.0% 0.0% 0.0% 0.0% 2.23sec 2384068 25.00sec
Feretory_RB Feretory_RB_lord_of_flames_infernal immolation ticks -19483 2055210 6851 4.47 40367 80717 1.0 22.4 13.9% 0.0% 0.0% 0.0% 0.00sec 2055210 25.00sec
Feretory_RB Feretory_RB_lord_of_flames_infernal melee 0 614428 24576 53.65 24138 48291 22.4 22.4 13.9% 0.0% 0.0% 0.0% 1.09sec 903268 25.00sec
Feretory_RB Feretory_RB_lord_of_flames_infernal immolation ticks -19483 2055499 6852 4.47 40365 80734 1.0 22.4 13.9% 0.0% 0.0% 0.0% 0.00sec 2055499 25.00sec
Feretory_RB Feretory_RB_lord_of_flames_infernal melee 0 615475 24618 53.65 24137 48297 22.4 22.4 14.1% 0.0% 0.0% 0.0% 1.09sec 904807 25.00sec
Feretory_RB Feretory_RB_lord_of_flames_infernal immolation ticks -19483 2055907 6853 4.47 40364 80752 1.0 22.4 13.9% 0.0% 0.0% 0.0% 0.00sec 2055907 25.00sec
Feretory_RB Feretory_RB_lord_of_flames_infernal melee 0 614984 24598 53.65 24139 48271 22.4 22.4 14.0% 0.0% 0.0% 0.0% 1.09sec 904085 25.00sec
Feretory_RB Feretory_RB_shadowy_tear shadow_bolt ticks -196657 5753284 19178 9.33 108881 217632 4.4 46.6 14.0% 0.0% 0.0% 0.0% 59.63sec 5753284 51.75sec
Feretory_RB Feretory_RB_chaos_tear chaos_bolt 215279 2796851 134832 12.54 0 645146 4.4 4.3 100.0% 0.0% 0.0% 0.0% 59.25sec 2796851 20.74sec
Feretory_RB Feretory_RB_chaos_portal chaos_barrage ticks -187394 5194863 17316 29.53 31025 62056 4.4 147.7 13.9% 0.0% 0.0% 0.0% 59.94sec 5194863 22.67sec
Lessons_of_Space-Time Lessons_of_Space-Time augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.97sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time chaos_bolt 116858 89110353 295935 22.53 0 787932 58.7 113.1 100.0% 0.0% 0.0% 0.0% 4.98sec 89110353 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time conflagrate 17962 32801709 108934 19.59 197847 444516 49.2 98.3 55.1% 0.0% 0.0% 0.0% 6.11sec 32801709 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time deadly_grace 188091 4091391 13588 6.63 108047 216102 33.3 33.3 13.9% 0.0% 0.0% 0.0% 4.96sec 4091391 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time dimensional_rift 196586 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.44sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time havoc 80240 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.66sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time immolate 348 7711164 25609 7.78 135288 270540 20.2 39.0 46.0% 0.0% 0.0% 0.0% 15.07sec 74812132 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time immolate ticks -348 67100968 223670 60.61 151719 303210 20.2 303.1 46.0% 0.0% 0.0% 0.0% 15.07sec 74812132 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time incinerate 29722 38516491 127913 30.23 222801 445543 78.8 151.7 14.0% 0.0% 0.0% 0.0% 3.64sec 38516491 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time life_tap 1454 0 0 0.00 0 0 15.3 0.0 0.0% 0.0% 0.0% 0.0% 20.41sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time mark_of_the_hidden_satyr 191259 2922640 9706 4.05 126143 252102 20.3 20.3 13.9% 0.0% 0.0% 0.0% 14.68sec 2922640 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 92.14sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.13sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time_imp firebolt 3110 12662784 42053 21.88 101206 202384 110.7 109.8 13.9% 0.0% 0.0% 0.0% 2.72sec 12662784 301.11sec
Lessons_of_Space-Time Lessons_of_Space-Time_service_imp firebolt 3110 11468708 119949 30.73 205672 411261 49.2 49.0 13.9% 0.0% 0.0% 0.0% 5.52sec 11468708 95.61sec
Lessons_of_Space-Time Lessons_of_Space-Time_infernal immolation ticks -19483 2075340 6918 4.54 40130 80270 1.0 22.7 13.9% 0.0% 0.0% 0.0% 0.00sec 2075340 25.00sec
Lessons_of_Space-Time Lessons_of_Space-Time_infernal melee 0 621124 24844 54.49 23999 47983 22.7 22.7 14.0% 0.0% 0.0% 0.0% 1.09sec 913111 25.00sec
Lessons_of_Space-Time Lessons_of_Space-Time_doomguard doom_bolt 85692 2372507 94897 26.41 189168 378481 11.0 11.0 14.0% 0.0% 0.0% 0.0% 2.21sec 2372507 25.00sec
Lessons_of_Space-Time Lessons_of_Space-Time_lord_of_flames_infernal immolation ticks -19483 2075834 6919 4.54 40132 80243 1.0 22.7 13.9% 0.0% 0.0% 0.0% 0.00sec 2075834 25.00sec
Lessons_of_Space-Time Lessons_of_Space-Time_lord_of_flames_infernal melee 0 621358 24853 54.49 23998 48003 22.7 22.7 14.0% 0.0% 0.0% 0.0% 1.09sec 913456 25.00sec
Lessons_of_Space-Time Lessons_of_Space-Time_lord_of_flames_infernal immolation ticks -19483 2075210 6917 4.54 40129 80278 1.0 22.7 13.9% 0.0% 0.0% 0.0% 0.00sec 2075210 25.00sec
Lessons_of_Space-Time Lessons_of_Space-Time_lord_of_flames_infernal melee 0 620595 24823 54.49 23998 48003 22.7 22.7 13.9% 0.0% 0.0% 0.0% 1.09sec 912333 25.00sec
Lessons_of_Space-Time Lessons_of_Space-Time_lord_of_flames_infernal immolation ticks -19483 2074858 6916 4.54 40127 80314 1.0 22.7 13.9% 0.0% 0.0% 0.0% 0.00sec 2074858 25.00sec
Lessons_of_Space-Time Lessons_of_Space-Time_lord_of_flames_infernal melee 0 621020 24840 54.49 23997 48013 22.7 22.7 14.0% 0.0% 0.0% 0.0% 1.09sec 912958 25.00sec
Lessons_of_Space-Time Lessons_of_Space-Time_shadowy_tear shadow_bolt ticks -196657 5803935 19346 9.39 109079 217994 4.4 46.9 14.0% 0.0% 0.0% 0.0% 59.15sec 5803935 51.89sec
Lessons_of_Space-Time Lessons_of_Space-Time_chaos_tear chaos_bolt 215279 2783169 133841 12.51 0 642054 4.4 4.3 100.0% 0.0% 0.0% 0.0% 58.83sec 2783169 20.79sec
Lessons_of_Space-Time Lessons_of_Space-Time_chaos_portal chaos_barrage ticks -187394 5177287 17258 29.60 30858 61714 4.4 148.0 13.9% 0.0% 0.0% 0.0% 60.21sec 5177287 22.69sec
Magistrike's_Restraints Magistrike's_Restraints augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.65sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints chaos_bolt 116858 89725249 297978 22.12 0 808327 57.7 111.0 100.0% 0.0% 0.0% 0.0% 5.05sec 89725249 301.11sec
Magistrike's_Restraints Magistrike's_Restraints conflagrate 17962 32746154 108750 19.24 199499 452345 48.3 96.6 55.2% 0.0% 0.0% 0.0% 6.22sec 32746154 301.11sec
Magistrike's_Restraints Magistrike's_Restraints deadly_grace 188091 4051021 13453 6.48 107668 215428 32.5 32.5 15.7% 0.0% 0.0% 0.0% 5.07sec 4051021 301.11sec
Magistrike's_Restraints Magistrike's_Restraints dimensional_rift 196586 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.64sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints havoc 80240 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.69sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints immolate 348 7805024 25920 7.70 136641 273342 19.9 38.6 47.9% 0.0% 0.0% 0.0% 15.37sec 74095403 301.11sec
Magistrike's_Restraints Magistrike's_Restraints immolate ticks -348 66290379 220968 59.18 151806 303406 19.9 295.9 47.6% 0.0% 0.0% 0.0% 15.37sec 74095403 301.11sec
Magistrike's_Restraints Magistrike's_Restraints incinerate 29722 38086724 126486 29.16 225056 450290 75.9 146.3 15.6% 0.0% 0.0% 0.0% 3.78sec 38086724 301.11sec
Magistrike's_Restraints Magistrike's_Restraints life_tap 1454 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.64sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints mark_of_the_hidden_satyr 191259 2878247 9559 3.95 125471 250769 19.8 19.8 15.6% 0.0% 0.0% 0.0% 15.07sec 2878247 301.11sec
Magistrike's_Restraints Magistrike's_Restraints potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.87sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.19sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Magistrike's_Restraints Magistrike's_Restraints_imp firebolt 3110 12523570 41591 21.42 100703 201398 108.3 107.5 15.7% 0.0% 0.0% 0.0% 2.78sec 12523570 301.11sec
Magistrike's_Restraints Magistrike's_Restraints_service_imp firebolt 3110 11489057 119971 30.44 204332 408705 48.8 48.6 15.7% 0.0% 0.0% 0.0% 5.56sec 11489057 95.77sec
Magistrike's_Restraints Magistrike's_Restraints_infernal immolation ticks -19483 2032009 6773 4.40 39940 79886 1.0 22.0 15.6% 0.0% 0.0% 0.0% 0.00sec 2032009 25.00sec
Magistrike's_Restraints Magistrike's_Restraints_infernal melee 0 607177 24286 52.81 23886 47751 22.0 22.0 15.5% 0.0% 0.0% 0.0% 1.11sec 892608 25.00sec
Magistrike's_Restraints Magistrike's_Restraints_doomguard doom_bolt 85692 2312964 92515 25.49 188279 376583 10.6 10.6 15.7% 0.0% 0.0% 0.0% 2.26sec 2312964 25.00sec
Magistrike's_Restraints Magistrike's_Restraints_lord_of_flames_infernal immolation ticks -19483 2034722 6782 4.40 39942 79869 1.0 22.0 15.7% 0.0% 0.0% 0.0% 0.00sec 2034722 25.00sec
Magistrike's_Restraints Magistrike's_Restraints_lord_of_flames_infernal melee 0 607375 24294 52.81 23884 47773 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.11sec 892899 25.00sec
Magistrike's_Restraints Magistrike's_Restraints_lord_of_flames_infernal immolation ticks -19483 2033705 6779 4.40 39940 79893 1.0 22.0 15.7% 0.0% 0.0% 0.0% 0.00sec 2033705 25.00sec
Magistrike's_Restraints Magistrike's_Restraints_lord_of_flames_infernal melee 0 608495 24339 52.81 23883 47792 22.0 22.0 15.8% 0.0% 0.0% 0.0% 1.11sec 894545 25.00sec
Magistrike's_Restraints Magistrike's_Restraints_lord_of_flames_infernal immolation ticks -19483 2032430 6775 4.40 39936 79931 1.0 22.0 15.6% 0.0% 0.0% 0.0% 0.00sec 2032430 25.00sec
Magistrike's_Restraints Magistrike's_Restraints_lord_of_flames_infernal melee 0 607878 24314 52.81 23885 47764 22.0 22.0 15.6% 0.0% 0.0% 0.0% 1.11sec 893638 25.00sec
Magistrike's_Restraints Magistrike's_Restraints_shadowy_tear shadow_bolt ticks -196657 5691341 18971 9.27 106859 213726 4.4 46.3 15.6% 0.0% 0.0% 0.0% 59.21sec 5691341 51.60sec
Magistrike's_Restraints Magistrike's_Restraints_chaos_tear chaos_bolt 215279 2778526 135344 12.51 0 649050 4.3 4.3 100.0% 0.0% 0.0% 0.0% 60.04sec 2778526 20.53sec
Magistrike's_Restraints Magistrike's_Restraints_chaos_portal chaos_barrage ticks -187394 5109688 17032 28.92 30709 61407 4.4 144.6 15.6% 0.0% 0.0% 0.0% 60.22sec 5109688 22.65sec
Norgannon's Norgannon's augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Norgannon's Norgannon's berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 181.03sec 0 301.11sec
Norgannon's Norgannon's chaos_bolt 116858 88246739 293067 22.50 0 781590 58.5 112.9 100.0% 0.0% 0.0% 0.0% 5.00sec 88246739 301.11sec
Norgannon's Norgannon's conflagrate 17962 32735505 108715 19.70 199738 442243 49.5 98.9 54.1% 0.0% 0.0% 0.0% 6.07sec 32735505 301.11sec
Norgannon's Norgannon's deadly_grace 188091 4063210 13494 6.67 108405 216934 33.5 33.5 11.9% 0.0% 0.0% 0.0% 4.94sec 4063210 301.11sec
Norgannon's Norgannon's dimensional_rift 196586 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.36sec 0 301.11sec
Norgannon's Norgannon's flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Norgannon's Norgannon's food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Norgannon's Norgannon's havoc 80240 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.65sec 0 301.11sec
Norgannon's Norgannon's immolate 348 7684061 25519 7.81 136426 272667 20.3 39.2 43.8% 0.0% 0.0% 0.0% 14.96sec 75195096 301.11sec
Norgannon's Norgannon's immolate ticks -348 67511035 225037 61.01 153856 307820 20.3 305.0 43.8% 0.0% 0.0% 0.0% 14.96sec 75195096 301.11sec
Norgannon's Norgannon's incinerate 29722 38797936 128848 30.70 225199 450581 80.0 154.1 11.8% 0.0% 0.0% 0.0% 3.58sec 38797936 301.11sec
Norgannon's Norgannon's life_tap 1454 0 0 0.00 0 0 15.3 0.0 0.0% 0.0% 0.0% 0.0% 20.46sec 0 301.11sec
Norgannon's Norgannon's mark_of_the_hidden_satyr 191259 2884272 9579 4.07 126306 252407 20.4 20.4 11.8% 0.0% 0.0% 0.0% 14.60sec 2884272 301.11sec
Norgannon's Norgannon's potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Norgannon's Norgannon's service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 92.15sec 0 301.11sec
Norgannon's Norgannon's soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.32sec 0 301.11sec
Norgannon's Norgannon's summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Norgannon's Norgannon's summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Norgannon's Norgannon's summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Norgannon's Norgannon's_imp firebolt 3110 12509145 41543 22.02 101302 202595 111.3 110.5 11.8% 0.0% 0.0% 0.0% 2.70sec 12509145 301.11sec
Norgannon's Norgannon's_service_imp firebolt 3110 11289985 118103 30.74 206084 412083 49.2 49.0 11.9% 0.0% 0.0% 0.0% 5.51sec 11289985 95.59sec
Norgannon's Norgannon's_infernal immolation ticks -19483 2061219 6871 4.59 40139 80270 1.0 23.0 11.9% 0.0% 0.0% 0.0% 0.00sec 2061219 25.00sec
Norgannon's Norgannon's_infernal melee 0 615168 24606 55.09 24003 48007 23.0 23.0 11.7% 0.0% 0.0% 0.0% 1.08sec 904355 25.00sec
Norgannon's Norgannon's_doomguard doom_bolt 85692 2331335 93250 26.42 189447 378966 11.0 11.0 11.8% 0.0% 0.0% 0.0% 2.20sec 2331335 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal immolation ticks -19483 2059004 6863 4.59 40138 80283 1.0 23.0 11.7% 0.0% 0.0% 0.0% 0.00sec 2059004 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal melee 0 615811 24631 55.09 24002 48016 23.0 23.0 11.8% 0.0% 0.0% 0.0% 1.08sec 905300 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal immolation ticks -19483 2060144 6867 4.59 40139 80275 1.0 23.0 11.8% 0.0% 0.0% 0.0% 0.00sec 2060144 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal melee 0 615983 24638 55.09 24004 47986 23.0 23.0 11.8% 0.0% 0.0% 0.0% 1.08sec 905554 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal immolation ticks -19483 2060082 6867 4.59 40139 80264 1.0 23.0 11.8% 0.0% 0.0% 0.0% 0.00sec 2060082 25.00sec
Norgannon's Norgannon's_lord_of_flames_infernal melee 0 616491 24659 55.09 24002 48014 23.0 23.0 11.9% 0.0% 0.0% 0.0% 1.08sec 906300 25.00sec
Norgannon's Norgannon's_shadowy_tear shadow_bolt ticks -196657 5776454 19255 9.48 109526 218758 4.4 47.4 11.9% 0.0% 0.0% 0.0% 58.76sec 5776454 52.16sec
Norgannon's Norgannon's_chaos_tear chaos_bolt 215279 2760930 131870 12.54 0 631148 4.4 4.4 100.0% 0.0% 0.0% 0.0% 59.73sec 2760930 20.94sec
Norgannon's Norgannon's_chaos_portal chaos_barrage ticks -187394 5143834 17146 29.91 30903 61817 4.4 149.5 11.8% 0.0% 0.0% 0.0% 59.69sec 5143834 22.81sec
Odr Odr augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Odr Odr berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.74sec 0 301.11sec
Odr Odr chaos_bolt 116858 89014829 295618 22.21 0 798685 58.1 111.5 100.0% 0.0% 0.0% 0.0% 5.03sec 89014829 301.11sec
Odr Odr conflagrate 17962 32747874 108756 19.35 197595 448437 48.6 97.1 55.7% 0.0% 0.0% 0.0% 6.18sec 32747874 301.11sec
Odr Odr deadly_grace 188091 4084951 13566 6.53 107769 215385 32.8 32.8 15.7% 0.0% 0.0% 0.0% 5.04sec 4084951 301.11sec
Odr Odr dimensional_rift 196586 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.50sec 0 301.11sec
Odr Odr flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Odr Odr food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Odr Odr havoc 80240 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.68sec 0 301.11sec
Odr Odr immolate 348 7760561 25773 7.73 135453 270814 20.0 38.8 47.7% 0.0% 0.0% 0.0% 15.25sec 74068687 301.11sec
Odr Odr immolate ticks -348 66308125 221027 59.66 150479 301170 20.0 298.3 47.6% 0.0% 0.0% 0.0% 15.25sec 74068687 301.11sec
Odr Odr incinerate 29722 38077729 126456 29.48 222415 444410 76.7 148.0 15.7% 0.0% 0.0% 0.0% 3.73sec 38077729 301.11sec
Odr Odr life_tap 1454 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 20.53sec 0 301.11sec
Odr Odr mark_of_the_hidden_satyr 191259 2907369 9655 3.99 125380 250581 20.0 20.0 15.7% 0.0% 0.0% 0.0% 14.86sec 2907369 301.11sec
Odr Odr potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Odr Odr service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 92.00sec 0 301.11sec
Odr Odr soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.03sec 0 301.11sec
Odr Odr summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Odr Odr summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Odr Odr summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Odr Odr_imp firebolt 3110 12592352 41819 21.56 100582 201237 109.0 108.2 15.7% 0.0% 0.0% 0.0% 2.76sec 12592352 301.11sec
Odr Odr_service_imp firebolt 3110 11560740 120793 30.69 204172 408077 49.2 48.9 15.7% 0.0% 0.0% 0.0% 5.52sec 11560740 95.71sec
Odr Odr_infernal immolation ticks -19483 2039839 6799 4.41 39968 79939 1.0 22.1 15.7% 0.0% 0.0% 0.0% 0.00sec 2039839 25.00sec
Odr Odr_infernal melee 0 609324 24372 52.95 23902 47793 22.1 22.1 15.6% 0.0% 0.0% 0.0% 1.10sec 895765 25.00sec
Odr Odr_doomguard doom_bolt 85692 2373766 94948 26.17 188108 376020 10.9 10.9 15.8% 0.0% 0.0% 0.0% 2.25sec 2373766 25.00sec
Odr Odr_lord_of_flames_infernal immolation ticks -19483 2039656 6799 4.41 39966 79960 1.0 22.1 15.6% 0.0% 0.0% 0.0% 0.00sec 2039656 25.00sec
Odr Odr_lord_of_flames_infernal melee 0 609965 24398 52.95 23901 47804 22.1 22.1 15.7% 0.0% 0.0% 0.0% 1.10sec 896707 25.00sec
Odr Odr_lord_of_flames_infernal immolation ticks -19483 2040161 6801 4.41 39970 79909 1.0 22.1 15.7% 0.0% 0.0% 0.0% 0.00sec 2040161 25.00sec
Odr Odr_lord_of_flames_infernal melee 0 609953 24397 52.95 23902 47794 22.1 22.1 15.7% 0.0% 0.0% 0.0% 1.10sec 896689 25.00sec
Odr Odr_lord_of_flames_infernal immolation ticks -19483 2040683 6802 4.41 39968 79936 1.0 22.1 15.7% 0.0% 0.0% 0.0% 0.00sec 2040683 25.00sec
Odr Odr_lord_of_flames_infernal melee 0 609995 24399 52.95 23905 47762 22.1 22.1 15.7% 0.0% 0.0% 0.0% 1.10sec 896751 25.00sec
Odr Odr_shadowy_tear shadow_bolt ticks -196657 5776852 19256 9.35 107312 214948 4.4 46.7 15.7% 0.0% 0.0% 0.0% 59.16sec 5776852 51.81sec
Odr Odr_chaos_tear chaos_bolt 215279 2806500 135243 12.52 0 648008 4.4 4.3 100.0% 0.0% 0.0% 0.0% 58.94sec 2806500 20.75sec
Odr Odr_chaos_portal chaos_barrage ticks -187394 5079945 16933 28.79 30652 61296 4.3 143.9 15.7% 0.0% 0.0% 0.0% 59.66sec 5079945 22.36sec
Portal_Pants Portal_Pants augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Portal_Pants Portal_Pants berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.61sec 0 301.11sec
Portal_Pants Portal_Pants chaos_bolt 116858 90430611 300320 21.85 0 824704 56.8 109.7 100.0% 0.0% 0.0% 0.0% 5.15sec 90430611 301.11sec
Portal_Pants Portal_Pants conflagrate 17962 33035679 109711 19.10 205479 462216 47.9 95.9 54.2% 0.0% 0.0% 0.0% 6.26sec 33035679 301.11sec
Portal_Pants Portal_Pants deadly_grace 188091 4034076 13397 6.44 108989 218113 32.3 32.3 14.5% 0.0% 0.0% 0.0% 5.10sec 4034076 301.11sec
Portal_Pants Portal_Pants dimensional_rift 196586 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 23.66sec 0 301.11sec
Portal_Pants Portal_Pants flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Portal_Pants Portal_Pants food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Portal_Pants Portal_Pants havoc 80240 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 20.69sec 0 301.11sec
Portal_Pants Portal_Pants immolate 348 7902952 26246 7.65 140750 281521 19.7 38.4 46.3% 0.0% 0.0% 0.0% 15.50sec 74915643 301.11sec
Portal_Pants Portal_Pants immolate ticks -348 67012691 223376 58.68 156097 312170 19.7 293.4 46.3% 0.0% 0.0% 0.0% 15.50sec 74915643 301.11sec
Portal_Pants Portal_Pants incinerate 29722 38699341 128520 29.00 232535 464965 75.4 145.5 14.4% 0.0% 0.0% 0.0% 3.79sec 38699341 301.11sec
Portal_Pants Portal_Pants life_tap 1454 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.75sec 0 301.11sec
Portal_Pants Portal_Pants mark_of_the_hidden_satyr 191259 2881257 9569 3.92 127859 255787 19.7 19.7 14.4% 0.0% 0.0% 0.0% 15.14sec 2881257 301.11sec
Portal_Pants Portal_Pants potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Portal_Pants Portal_Pants service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.93sec 0 301.11sec
Portal_Pants Portal_Pants soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.17sec 0 301.11sec
Portal_Pants Portal_Pants summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Portal_Pants Portal_Pants summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Portal_Pants Portal_Pants summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Portal_Pants Portal_Pants_imp firebolt 3110 12509278 41543 21.24 102643 205407 107.4 106.6 14.3% 0.0% 0.0% 0.0% 2.80sec 12509278 301.11sec
Portal_Pants Portal_Pants_service_imp firebolt 3110 11401052 119082 29.97 208472 416965 48.1 47.8 14.4% 0.0% 0.0% 0.0% 5.63sec 11401052 95.74sec
Portal_Pants Portal_Pants_infernal immolation ticks -19483 2045236 6817 4.40 40659 81326 1.0 22.0 14.4% 0.0% 0.0% 0.0% 0.00sec 2045236 25.00sec
Portal_Pants Portal_Pants_infernal melee 0 611131 24444 52.78 24314 48638 22.0 22.0 14.3% 0.0% 0.0% 0.0% 1.12sec 898420 25.00sec
Portal_Pants Portal_Pants_doomguard doom_bolt 85692 2259387 90373 24.66 192080 384072 10.3 10.3 14.5% 0.0% 0.0% 0.0% 2.28sec 2259387 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal immolation ticks -19483 2045843 6819 4.40 40657 81349 1.0 22.0 14.4% 0.0% 0.0% 0.0% 0.00sec 2045843 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal melee 0 611378 24454 52.78 24315 48616 22.0 22.0 14.3% 0.0% 0.0% 0.0% 1.12sec 898783 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal immolation ticks -19483 2045823 6819 4.40 40660 81310 1.0 22.0 14.4% 0.0% 0.0% 0.0% 0.00sec 2045823 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal melee 0 611803 24471 52.78 24310 48677 22.0 22.0 14.4% 0.0% 0.0% 0.0% 1.12sec 899409 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal immolation ticks -19483 2045034 6817 4.40 40659 81320 1.0 22.0 14.3% 0.0% 0.0% 0.0% 0.00sec 2045034 25.00sec
Portal_Pants Portal_Pants_lord_of_flames_infernal melee 0 610677 24426 52.78 24316 48613 22.0 22.0 14.2% 0.0% 0.0% 0.0% 1.12sec 897752 25.00sec
Portal_Pants Portal_Pants_shadowy_tear shadow_bolt ticks -196657 5633068 18777 9.15 108332 216645 4.3 45.8 14.3% 0.0% 0.0% 0.0% 60.17sec 5633068 51.03sec
Portal_Pants Portal_Pants_chaos_tear chaos_bolt 215279 2824111 136481 12.51 0 654579 4.3 4.3 100.0% 0.0% 0.0% 0.0% 58.73sec 2824111 20.69sec
Portal_Pants Portal_Pants_chaos_portal chaos_barrage ticks -187394 5078821 16929 28.49 31315 62663 4.3 142.4 14.4% 0.0% 0.0% 0.0% 60.30sec 5078821 22.49sec
Prydaz Prydaz augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Prydaz Prydaz berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.70sec 0 301.11sec
Prydaz Prydaz chaos_bolt 116858 91877716 305126 22.16 0 826060 58.0 111.2 100.0% 0.0% 0.0% 0.0% 5.05sec 91877716 301.11sec
Prydaz Prydaz conflagrate 17962 33759774 112116 19.33 204564 463616 48.5 97.0 55.3% 0.0% 0.0% 0.0% 6.19sec 33759774 301.11sec
Prydaz Prydaz deadly_grace 188091 4086137 13570 6.52 108312 216573 32.7 32.7 15.3% 0.0% 0.0% 0.0% 5.03sec 4086137 301.11sec
Prydaz Prydaz dimensional_rift 196586 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.43sec 0 301.11sec
Prydaz Prydaz flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Prydaz Prydaz food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Prydaz Prydaz havoc 80240 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 20.69sec 0 301.11sec
Prydaz Prydaz immolate 348 8022074 26641 7.73 140198 280444 19.9 38.8 47.6% 0.0% 0.0% 0.0% 15.28sec 76459969 301.11sec
Prydaz Prydaz immolate ticks -348 68437895 228126 59.55 155905 311993 19.9 297.8 47.4% 0.0% 0.0% 0.0% 15.28sec 76459969 301.11sec
Prydaz Prydaz incinerate 29722 39272299 130423 29.41 230574 461307 76.5 147.6 15.4% 0.0% 0.0% 0.0% 3.74sec 39272299 301.11sec
Prydaz Prydaz life_tap 1454 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 20.54sec 0 301.11sec
Prydaz Prydaz mark_of_the_hidden_satyr 191259 2877846 9557 3.98 124769 249586 20.0 20.0 15.4% 0.0% 0.0% 0.0% 14.96sec 2877846 301.11sec
Prydaz Prydaz potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Prydaz Prydaz service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.93sec 0 301.11sec
Prydaz Prydaz soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.04sec 0 301.11sec
Prydaz Prydaz summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Prydaz Prydaz summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Prydaz Prydaz summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Prydaz Prydaz_imp firebolt 3110 12484411 41461 21.53 100090 200212 108.9 108.1 15.4% 0.0% 0.0% 0.0% 2.76sec 12484411 301.11sec
Prydaz Prydaz_service_imp firebolt 3110 11466570 119786 30.64 203138 406242 49.2 48.9 15.5% 0.0% 0.0% 0.0% 5.53sec 11466570 95.73sec
Prydaz Prydaz_infernal immolation ticks -19483 2021999 6740 4.41 39761 79516 1.0 22.0 15.4% 0.0% 0.0% 0.0% 0.00sec 2021999 25.00sec
Prydaz Prydaz_infernal melee 0 604369 24174 52.90 23775 47570 22.0 22.0 15.3% 0.0% 0.0% 0.0% 1.10sec 888479 25.00sec
Prydaz Prydaz_doomguard doom_bolt 85692 2343347 93731 26.06 187168 374081 10.9 10.9 15.3% 0.0% 0.0% 0.0% 2.25sec 2343347 25.00sec
Prydaz Prydaz_lord_of_flames_infernal immolation ticks -19483 2023020 6743 4.41 39763 79493 1.0 22.0 15.4% 0.0% 0.0% 0.0% 0.00sec 2023020 25.00sec
Prydaz Prydaz_lord_of_flames_infernal melee 0 604487 24179 52.90 23774 47582 22.0 22.0 15.3% 0.0% 0.0% 0.0% 1.10sec 888653 25.00sec
Prydaz Prydaz_lord_of_flames_infernal immolation ticks -19483 2021572 6739 4.41 39760 79531 1.0 22.0 15.3% 0.0% 0.0% 0.0% 0.00sec 2021572 25.00sec
Prydaz Prydaz_lord_of_flames_infernal melee 0 604880 24194 52.90 23778 47540 22.0 22.0 15.4% 0.0% 0.0% 0.0% 1.10sec 889232 25.00sec
Prydaz Prydaz_lord_of_flames_infernal immolation ticks -19483 2023021 6743 4.41 39762 79505 1.0 22.0 15.4% 0.0% 0.0% 0.0% 0.00sec 2023021 25.00sec
Prydaz Prydaz_lord_of_flames_infernal melee 0 604839 24193 52.90 23779 47528 22.0 22.0 15.4% 0.0% 0.0% 0.0% 1.10sec 889170 25.00sec
Prydaz Prydaz_shadowy_tear shadow_bolt ticks -196657 5660054 18867 9.24 106696 213498 4.3 46.2 15.4% 0.0% 0.0% 0.0% 59.57sec 5660054 51.29sec
Prydaz Prydaz_chaos_tear chaos_bolt 215279 2780646 133962 12.50 0 643139 4.4 4.3 100.0% 0.0% 0.0% 0.0% 59.22sec 2780646 20.76sec
Prydaz Prydaz_chaos_portal chaos_barrage ticks -187394 5117561 17059 29.21 30502 61020 4.4 146.0 15.4% 0.0% 0.0% 0.0% 59.22sec 5117561 22.74sec
Sephuz Sephuz augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sephuz Sephuz berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.86sec 0 301.11sec
Sephuz Sephuz chaos_bolt 116858 89047887 295728 22.89 0 775119 59.8 114.9 100.0% 0.0% 0.0% 0.0% 4.89sec 89047887 301.11sec
Sephuz Sephuz conflagrate 17962 32093312 106582 19.48 184043 430704 48.9 97.8 58.5% 0.0% 0.0% 0.0% 6.14sec 32093312 301.11sec
Sephuz Sephuz deadly_grace 188091 4311058 14317 6.57 108406 216933 33.0 33.0 20.6% 0.0% 0.0% 0.0% 5.02sec 4311058 301.11sec
Sephuz Sephuz dimensional_rift 196586 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.54sec 0 301.11sec
Sephuz Sephuz flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sephuz Sephuz food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sephuz Sephuz havoc 80240 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.67sec 0 301.11sec
Sephuz Sephuz immolate 348 7480700 24843 7.76 125906 251832 20.1 39.0 52.5% 0.0% 0.0% 0.0% 15.14sec 72009575 301.11sec
Sephuz Sephuz immolate ticks -348 64528875 215096 60.20 140425 280825 20.1 301.0 52.7% 0.0% 0.0% 0.0% 15.14sec 72009575 301.11sec
Sephuz Sephuz incinerate 29722 36809559 122245 29.38 207000 414035 76.6 147.4 20.6% 0.0% 0.0% 0.0% 3.74sec 36809559 301.11sec
Sephuz Sephuz life_tap 1454 0 0 0.00 0 0 15.3 0.0 0.0% 0.0% 0.0% 0.0% 20.42sec 0 301.11sec
Sephuz Sephuz mark_of_the_hidden_satyr 191259 3031719 10068 4.01 124784 249597 20.1 20.1 20.7% 0.0% 0.0% 0.0% 14.85sec 3031719 301.11sec
Sephuz Sephuz potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sephuz Sephuz service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 92.03sec 0 301.11sec
Sephuz Sephuz soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.97sec 0 301.11sec
Sephuz Sephuz summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sephuz Sephuz summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sephuz Sephuz summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sephuz Sephuz_imp firebolt 3110 13182506 43779 21.74 100145 200284 110.0 109.1 20.6% 0.0% 0.0% 0.0% 2.74sec 13182506 301.11sec
Sephuz Sephuz_service_imp firebolt 3110 12013948 125557 30.73 203294 406624 49.3 49.0 20.6% 0.0% 0.0% 0.0% 5.51sec 12013948 95.69sec
Sephuz Sephuz_infernal immolation ticks -19483 2143923 7146 4.47 39765 79524 1.0 22.3 20.7% 0.0% 0.0% 0.0% 0.00sec 2143923 25.00sec
Sephuz Sephuz_infernal melee 0 640582 25622 53.60 23777 47571 22.3 22.3 20.6% 0.0% 0.0% 0.0% 1.09sec 941716 25.00sec
Sephuz Sephuz_doomguard doom_bolt 85692 2485612 99423 26.40 187093 374547 11.0 11.0 20.7% 0.0% 0.0% 0.0% 2.23sec 2485612 25.00sec
Sephuz Sephuz_lord_of_flames_infernal immolation ticks -19483 2144332 7148 4.47 39764 79530 1.0 22.3 20.7% 0.0% 0.0% 0.0% 0.00sec 2144332 25.00sec
Sephuz Sephuz_lord_of_flames_infernal melee 0 640244 25609 53.60 23779 47558 22.3 22.3 20.5% 0.0% 0.0% 0.0% 1.09sec 941219 25.00sec
Sephuz Sephuz_lord_of_flames_infernal immolation ticks -19483 2142655 7142 4.47 39763 79536 1.0 22.3 20.6% 0.0% 0.0% 0.0% 0.00sec 2142655 25.00sec
Sephuz Sephuz_lord_of_flames_infernal melee 0 640458 25617 53.60 23776 47584 22.3 22.3 20.6% 0.0% 0.0% 0.0% 1.09sec 941535 25.00sec
Sephuz Sephuz_lord_of_flames_infernal immolation ticks -19483 2143236 7144 4.47 39766 79512 1.0 22.3 20.7% 0.0% 0.0% 0.0% 0.00sec 2143236 25.00sec
Sephuz Sephuz_lord_of_flames_infernal melee 0 641016 25640 53.60 23781 47547 22.3 22.3 20.7% 0.0% 0.0% 0.0% 1.09sec 942355 25.00sec
Sephuz Sephuz_shadowy_tear shadow_bolt ticks -196657 5991241 19971 9.29 107463 214803 4.3 46.4 20.8% 0.0% 0.0% 0.0% 60.14sec 5991241 51.42sec
Sephuz Sephuz_chaos_tear chaos_bolt 215279 2913901 140265 12.52 0 672337 4.4 4.3 100.0% 0.0% 0.0% 0.0% 59.00sec 2913901 20.77sec
Sephuz Sephuz_chaos_portal chaos_barrage ticks -187394 5373261 17911 29.35 30515 61020 4.4 146.8 20.6% 0.0% 0.0% 0.0% 59.86sec 5373261 22.63sec
Sindorei_Spite Sindorei_Spite augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sindorei_Spite Sindorei_Spite berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.73sec 0 301.11sec
Sindorei_Spite Sindorei_Spite chaos_bolt 116858 91915941 305253 22.24 0 823534 58.2 111.6 100.0% 0.0% 0.0% 0.0% 5.02sec 91915941 301.11sec
Sindorei_Spite Sindorei_Spite conflagrate 17962 33558929 111449 19.37 202265 459667 48.6 97.2 55.6% 0.0% 0.0% 0.0% 6.18sec 33558929 301.11sec
Sindorei_Spite Sindorei_Spite deadly_grace 188091 4353091 14457 6.52 114956 229735 32.7 32.7 15.7% 0.0% 0.0% 0.0% 5.03sec 4353091 301.11sec
Sindorei_Spite Sindorei_Spite dimensional_rift 196586 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.58sec 0 301.11sec
Sindorei_Spite Sindorei_Spite flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sindorei_Spite Sindorei_Spite food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sindorei_Spite Sindorei_Spite havoc 80240 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 20.69sec 0 301.11sec
Sindorei_Spite Sindorei_Spite immolate 348 7909274 26267 7.73 137938 276034 20.0 38.8 47.7% 0.0% 0.0% 0.0% 15.26sec 76706122 301.11sec
Sindorei_Spite Sindorei_Spite immolate ticks -348 68796848 229323 59.70 155978 312144 20.0 298.5 47.7% 0.0% 0.0% 0.0% 15.26sec 76706122 301.11sec
Sindorei_Spite Sindorei_Spite incinerate 29722 39310720 130551 29.47 229685 459321 76.7 147.9 15.7% 0.0% 0.0% 0.0% 3.73sec 39310720 301.11sec
Sindorei_Spite Sindorei_Spite life_tap 1454 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 20.51sec 0 301.11sec
Sindorei_Spite Sindorei_Spite mark_of_the_hidden_satyr 191259 2987620 9922 3.99 129075 258117 20.0 20.0 15.5% 0.0% 0.0% 0.0% 15.02sec 2987620 301.11sec
Sindorei_Spite Sindorei_Spite potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sindorei_Spite Sindorei_Spite service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.98sec 0 301.11sec
Sindorei_Spite Sindorei_Spite soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.00sec 0 301.11sec
Sindorei_Spite Sindorei_Spite summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sindorei_Spite Sindorei_Spite summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sindorei_Spite Sindorei_Spite summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Sindorei_Spite Sindorei_Spite_imp firebolt 3110 12999900 43173 21.58 103775 207482 109.1 108.3 15.7% 0.0% 0.0% 0.0% 2.76sec 12999900 301.11sec
Sindorei_Spite Sindorei_Spite_service_imp firebolt 3110 12309310 128672 30.69 217379 435068 49.2 48.9 15.7% 0.0% 0.0% 0.0% 5.53sec 12309310 95.66sec
Sindorei_Spite Sindorei_Spite_infernal immolation ticks -19483 2349873 7833 4.41 45998 92053 1.0 22.1 15.7% 0.0% 0.0% 0.0% 0.00sec 2349873 25.00sec
Sindorei_Spite Sindorei_Spite_infernal melee 0 702244 28089 52.97 27510 55018 22.1 22.1 15.7% 0.0% 0.0% 0.0% 1.10sec 1032365 25.00sec
Sindorei_Spite Sindorei_Spite_doomguard doom_bolt 85692 2737390 109492 26.25 216512 433006 10.9 10.9 15.6% 0.0% 0.0% 0.0% 2.25sec 2737390 25.00sec
Sindorei_Spite Sindorei_Spite_lord_of_flames_infernal immolation ticks -19483 2350494 7835 4.41 46002 92008 1.0 22.1 15.7% 0.0% 0.0% 0.0% 0.00sec 2350494 25.00sec
Sindorei_Spite Sindorei_Spite_lord_of_flames_infernal melee 0 701642 28065 52.97 27511 55002 22.1 22.1 15.6% 0.0% 0.0% 0.0% 1.10sec 1031480 25.00sec
Sindorei_Spite Sindorei_Spite_lord_of_flames_infernal immolation ticks -19483 2349170 7831 4.41 46003 92006 1.0 22.1 15.7% 0.0% 0.0% 0.0% 0.00sec 2349170 25.00sec
Sindorei_Spite Sindorei_Spite_lord_of_flames_infernal melee 0 702871 28114 52.97 27507 55047 22.1 22.1 15.7% 0.0% 0.0% 0.0% 1.10sec 1033287 25.00sec
Sindorei_Spite Sindorei_Spite_lord_of_flames_infernal immolation ticks -19483 2349586 7832 4.41 46003 92002 1.0 22.1 15.7% 0.0% 0.0% 0.0% 0.00sec 2349586 25.00sec
Sindorei_Spite Sindorei_Spite_lord_of_flames_infernal melee 0 703197 28127 52.97 27508 55043 22.1 22.1 15.8% 0.0% 0.0% 0.0% 1.10sec 1033766 25.00sec
Sindorei_Spite Sindorei_Spite_shadowy_tear shadow_bolt ticks -196657 6115848 20386 9.36 113587 227136 4.4 46.8 15.7% 0.0% 0.0% 0.0% 59.86sec 6115848 51.95sec
Sindorei_Spite Sindorei_Spite_chaos_tear chaos_bolt 215279 2889359 140727 12.52 0 674588 4.3 4.3 100.0% 0.0% 0.0% 0.0% 59.50sec 2889359 20.53sec
Sindorei_Spite Sindorei_Spite_chaos_portal chaos_barrage ticks -187394 5433847 18113 29.25 32263 64532 4.4 146.2 15.7% 0.0% 0.0% 0.0% 59.98sec 5433847 22.70sec
Warlock_Destruction_T19M Warlock_Destruction_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.82sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M chaos_bolt 116858 87263424 289802 22.22 0 782455 58.1 111.5 100.0% 0.0% 0.0% 0.0% 5.02sec 87263424 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M conflagrate 17962 32268778 107165 19.44 196682 441551 48.8 97.6 54.8% 0.0% 0.0% 0.0% 6.15sec 32268778 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M deadly_grace 188091 4051255 13454 6.54 108394 216805 32.8 32.8 13.8% 0.0% 0.0% 0.0% 5.00sec 4051255 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M dimensional_rift 196586 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.56sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M havoc 80240 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 20.67sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M immolate 348 7641435 25377 7.75 134598 269167 20.0 38.9 45.9% 0.0% 0.0% 0.0% 15.18sec 73316348 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M immolate ticks -348 65674913 218916 60.03 150003 299950 20.0 300.1 45.9% 0.0% 0.0% 0.0% 15.18sec 73316348 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M incinerate 29722 37719296 125266 29.83 221220 442541 77.7 149.7 13.9% 0.0% 0.0% 0.0% 3.70sec 37719296 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M life_tap 1454 0 0 0.00 0 0 15.3 0.0 0.0% 0.0% 0.0% 0.0% 20.45sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M mark_of_the_hidden_satyr 191259 2859182 9495 4.01 124815 249380 20.1 20.1 13.8% 0.0% 0.0% 0.0% 14.89sec 2859182 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M service_imp 111859 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 92.08sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M soul_harvest 196098 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.95sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_imp firebolt 3110 12409680 41213 21.68 100122 200156 109.7 108.8 13.9% 0.0% 0.0% 0.0% 2.75sec 12409680 301.11sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_service_imp firebolt 3110 11338775 118556 30.72 203257 406282 49.2 49.0 13.9% 0.0% 0.0% 0.0% 5.52sec 11338775 95.64sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_infernal immolation ticks -19483 2012176 6707 4.44 39776 79559 1.0 22.2 13.9% 0.0% 0.0% 0.0% 0.00sec 2012176 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_infernal melee 0 601317 24052 53.29 23788 47557 22.2 22.2 13.8% 0.0% 0.0% 0.0% 1.10sec 883993 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_doomguard doom_bolt 85692 2343832 93750 26.39 187133 374483 11.0 11.0 13.9% 0.0% 0.0% 0.0% 2.23sec 2343832 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_lord_of_flames_infernal immolation ticks -19483 2012521 6708 4.44 39774 79579 1.0 22.2 13.9% 0.0% 0.0% 0.0% 0.00sec 2012521 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_lord_of_flames_infernal melee 0 602019 24080 53.29 23786 47580 22.2 22.2 14.0% 0.0% 0.0% 0.0% 1.10sec 885025 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_lord_of_flames_infernal immolation ticks -19483 2013631 6712 4.44 39774 79573 1.0 22.2 14.0% 0.0% 0.0% 0.0% 0.00sec 2013631 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_lord_of_flames_infernal melee 0 602071 24082 53.29 23786 47582 22.2 22.2 14.0% 0.0% 0.0% 0.0% 1.10sec 885101 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_lord_of_flames_infernal immolation ticks -19483 2012530 6708 4.44 39776 79553 1.0 22.2 13.9% 0.0% 0.0% 0.0% 0.00sec 2012530 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_lord_of_flames_infernal melee 0 602181 24086 53.29 23787 47568 22.2 22.2 14.0% 0.0% 0.0% 0.0% 1.10sec 885263 25.00sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_shadowy_tear shadow_bolt ticks -196657 5673437 18911 9.35 107097 214092 4.4 46.7 13.9% 0.0% 0.0% 0.0% 60.20sec 5673437 51.86sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_chaos_tear chaos_bolt 215279 2733415 132699 12.53 0 635550 4.3 4.3 100.0% 0.0% 0.0% 0.0% 59.70sec 2733415 20.60sec
Warlock_Destruction_T19M Warlock_Destruction_T19M_chaos_portal chaos_barrage ticks -187394 5058693 16862 29.24 30518 61072 4.4 146.2 14.0% 0.0% 0.0% 0.0% 59.69sec 5058693 22.63sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.57% 11.57% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.57%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.23% 10.23% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.23%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.65% 11.65% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.65%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.38% 11.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.40% 11.40% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.28% 11.28% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.35% 12.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.35%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.09% 10.09% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 4.84% 4.84% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:4.84%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.20% 5.20% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.20%

Trigger Attempt Success

  • trigger_pct:100.00%
Eradication 15.4 43.2 19.9sec 5.1sec 79.68% 79.68% 43.2(43.2) 14.5

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.3 43.2 20.0sec 5.1sec 79.65% 79.65% 43.2(43.2) 14.4

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.0 45.2 20.3sec 5.0sec 80.67% 80.67% 45.2(45.2) 14.2

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:80.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.0 45.7 20.4sec 4.9sec 80.78% 80.78% 45.7(45.7) 14.1

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:80.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.3 43.7 20.0sec 5.1sec 79.65% 79.65% 43.7(43.7) 14.4

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.3 42.0 20.0sec 5.2sec 78.72% 78.72% 42.0(42.0) 14.4

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:78.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.3 43.4 19.9sec 5.1sec 79.78% 79.78% 43.4(43.4) 14.5

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.3 43.0 20.0sec 5.2sec 79.45% 79.45% 43.0(43.0) 14.4

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.3 43.3 20.0sec 5.1sec 79.65% 79.65% 43.3(43.3) 14.4

Buff details

  • buff initial source:Odr
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 13.7 52.6 22.2sec 4.5sec 84.68% 84.68% 52.6(52.6) 12.8

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:84.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.2 55.6 24.8sec 4.4sec 91.01% 91.01% 55.6(55.6) 11.3

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:91.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.2 44.0 20.1sec 5.1sec 79.91% 79.91% 44.0(44.0) 14.3

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.3 42.7 20.0sec 5.2sec 79.19% 79.19% 42.7(42.7) 14.5

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.4 42.1 19.9sec 5.2sec 79.21% 79.21% 42.1(42.1) 14.5

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:79.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Havoc 0.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Odr
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:0.01%

Trigger Attempt Success

  • trigger_pct:0.48%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Roaring Blaze 10.1 38.7 31.7sec 6.2sec 72.11% 70.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.60%
  • roaring_blaze_2:9.38%
  • roaring_blaze_3:10.90%
  • roaring_blaze_4:16.60%
  • roaring_blaze_5:24.00%
  • roaring_blaze_6:3.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 38.5 31.7sec 6.2sec 72.02% 70.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.65%
  • roaring_blaze_2:9.49%
  • roaring_blaze_3:10.96%
  • roaring_blaze_4:16.63%
  • roaring_blaze_5:23.88%
  • roaring_blaze_6:3.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 38.8 31.6sec 6.1sec 72.17% 70.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.76%
  • roaring_blaze_2:9.48%
  • roaring_blaze_3:10.76%
  • roaring_blaze_4:16.45%
  • roaring_blaze_5:24.01%
  • roaring_blaze_6:3.72%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 39.2 31.6sec 6.1sec 72.23% 70.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.73%
  • roaring_blaze_2:9.48%
  • roaring_blaze_3:10.63%
  • roaring_blaze_4:16.27%
  • roaring_blaze_5:23.89%
  • roaring_blaze_6:4.23%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 39.3 31.5sec 6.1sec 72.31% 70.82% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.58%
  • roaring_blaze_2:9.39%
  • roaring_blaze_3:10.68%
  • roaring_blaze_4:16.31%
  • roaring_blaze_5:23.99%
  • roaring_blaze_6:4.36%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.0 38.0 32.0sec 6.3sec 71.38% 70.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.73%
  • roaring_blaze_2:9.69%
  • roaring_blaze_3:10.95%
  • roaring_blaze_4:16.69%
  • roaring_blaze_5:23.11%
  • roaring_blaze_6:3.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 38.5 31.7sec 6.2sec 72.07% 70.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.65%
  • roaring_blaze_2:9.46%
  • roaring_blaze_3:10.96%
  • roaring_blaze_4:16.60%
  • roaring_blaze_5:23.94%
  • roaring_blaze_6:3.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.0 38.3 31.8sec 6.2sec 71.85% 70.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.72%
  • roaring_blaze_2:9.58%
  • roaring_blaze_3:11.02%
  • roaring_blaze_4:16.61%
  • roaring_blaze_5:23.65%
  • roaring_blaze_6:3.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 38.5 31.7sec 6.2sec 72.06% 70.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:Odr
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.62%
  • roaring_blaze_2:9.48%
  • roaring_blaze_3:10.96%
  • roaring_blaze_4:16.62%
  • roaring_blaze_5:23.94%
  • roaring_blaze_6:3.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 38.6 31.2sec 6.1sec 72.07% 71.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.16%
  • roaring_blaze_2:9.39%
  • roaring_blaze_3:10.39%
  • roaring_blaze_4:16.49%
  • roaring_blaze_5:23.94%
  • roaring_blaze_6:3.70%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 39.1 31.6sec 6.1sec 72.16% 70.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.62%
  • roaring_blaze_2:9.45%
  • roaring_blaze_3:10.70%
  • roaring_blaze_4:16.41%
  • roaring_blaze_5:23.94%
  • roaring_blaze_6:4.04%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.0 38.2 31.9sec 6.2sec 71.73% 70.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.73%
  • roaring_blaze_2:9.56%
  • roaring_blaze_3:11.02%
  • roaring_blaze_4:16.68%
  • roaring_blaze_5:23.50%
  • roaring_blaze_6:3.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.1 39.0 31.6sec 6.1sec 72.17% 70.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.78%
  • roaring_blaze_2:9.77%
  • roaring_blaze_3:10.55%
  • roaring_blaze_4:16.21%
  • roaring_blaze_5:23.97%
  • roaring_blaze_6:3.90%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 7919666.67
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 10164
death count pct 101.61
avg death time 301.08
min death time 224.09
max death time 376.41
dmg taken 2384944185.98

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 301.11
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.29%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 7944005.38
Minimum 7486873.48
Maximum 8533504.35
Spread ( max - min ) 1046630.87
Range [ ( max - min ) / 2 * 100% ] 6.59%
Standard Deviation 182615.9670
5th Percentile 7645670.55
95th Percentile 8245706.13
( 95th Percentile - 5th Percentile ) 600035.58
Mean Distribution
Standard Deviation 1826.2510
95.00% Confidence Intervall ( 7940426.00 - 7947584.77 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2030
0.1 Scale Factor Error with Delta=300 284682758
0.05 Scale Factor Error with Delta=300 1138731029
0.01 Scale Factor Error with Delta=300 28468275715
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2505
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 2857620070 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.16% 9.16% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.16%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 11.64% 11.64% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:11.64%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.44% 11.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.20% 11.20% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.20%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.61% 10.61% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.61%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.19% 11.19% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.19%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.90% 11.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.90%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.48% 10.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.48%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.11% 6.11% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.11%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.28% 6.28% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Eradication 14.9 38.0 19.8sec 5.5sec 72.95% 72.95% 38.0(38.0) 14.1

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.9 37.9 19.9sec 5.5sec 72.79% 72.79% 37.9(37.9) 14.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.6 40.0 20.2sec 5.3sec 74.15% 74.15% 40.0(40.0) 13.8

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:74.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.6 40.8 20.3sec 5.2sec 74.84% 74.84% 40.8(40.8) 13.8

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:74.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.8 39.1 20.0sec 5.4sec 73.67% 73.67% 39.1(39.1) 14.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:73.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.8 37.5 20.0sec 5.5sec 72.34% 72.34% 37.5(37.5) 14.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.9 38.1 19.9sec 5.5sec 72.95% 72.95% 38.1(38.1) 14.1

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.9 37.9 19.9sec 5.5sec 72.80% 72.80% 37.9(37.9) 14.1

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.9 38.0 19.9sec 5.5sec 72.86% 72.86% 38.0(38.0) 14.1

Buff details

  • buff initial source:Odr
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 13.6 46.3 21.7sec 4.8sec 78.39% 78.39% 46.3(46.3) 12.8

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:78.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 12.9 49.3 22.9sec 4.7sec 85.37% 85.37% 49.3(49.3) 12.0

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:85.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.8 39.1 20.1sec 5.4sec 73.67% 73.67% 39.1(39.1) 14.0

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:73.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 15.0 37.3 19.8sec 5.5sec 72.37% 72.37% 37.3(37.3) 14.2

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 14.9 37.0 19.8sec 5.6sec 72.68% 72.68% 37.0(37.0) 14.1

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:72.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Havoc 15.1 0.0 20.7sec 20.7sec 96.90% 96.90% 0.0(0.0) 14.1

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:96.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 15.0 0.0 20.7sec 20.7sec 96.87% 96.87% 0.0(0.0) 14.1

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:96.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 15.1 0.0 20.7sec 20.7sec 96.92% 96.92% 0.0(0.0) 14.1

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:96.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 15.1 0.0 20.6sec 20.7sec 97.03% 97.03% 0.0(0.0) 14.1

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:97.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 15.1 0.0 20.6sec 20.6sec 97.05% 97.05% 0.0(0.0) 14.1

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:97.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 15.0 0.0 20.7sec 20.7sec 96.89% 96.89% 0.0(0.0) 14.1

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:96.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 15.0 0.0 20.7sec 20.7sec 96.87% 96.87% 0.0(0.0) 14.1

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:96.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 15.1 0.0 20.7sec 20.7sec 96.88% 96.88% 0.0(0.0) 14.1

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:96.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 15.0 0.0 20.7sec 20.7sec 96.89% 96.89% 0.0(0.0) 14.1

Buff details

  • buff initial source:Odr
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:96.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.96% 95.96% 0.0(0.0) 14.0

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 14.9 0.0 20.9sec 20.9sec 95.96% 95.96% 0.0(0.0) 14.0

Buff details

  • buff initial source:Feretory_BD
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:95.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 15.1 0.0 20.6sec 20.7sec 96.99% 96.99% 0.0(0.0) 14.1

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:96.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 15.1 0.0 20.7sec 20.7sec 96.93% 96.93% 0.0(0.0) 14.1

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:96.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Havoc 15.1 0.0 20.7sec 20.7sec 96.91% 96.91% 0.0(0.0) 14.1

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_havoc
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • havoc_1:96.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target.
  • description:Marks a target with Havoc for {$d=8 seconds}, causing your single target spells to also strike the Havoc victim. Limit 1.
  • max_stacks:1
  • duration:8.00
  • cooldown:20.00
  • default_chance:101.00%
Roaring Blaze 10.5 38.3 30.4sec 6.2sec 71.69% 70.66% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warlock_Destruction_T19M
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.25%
  • roaring_blaze_2:10.03%
  • roaring_blaze_3:10.75%
  • roaring_blaze_4:15.98%
  • roaring_blaze_5:23.05%
  • roaring_blaze_6:3.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.4 38.0 30.7sec 6.2sec 71.68% 70.69% 0.0(0.0) 0.0

Buff details

  • buff initial source:Prydaz
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.17%
  • roaring_blaze_2:10.08%
  • roaring_blaze_3:10.82%
  • roaring_blaze_4:16.11%
  • roaring_blaze_5:23.09%
  • roaring_blaze_6:3.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.5 38.3 30.3sec 6.1sec 71.74% 70.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sephuz
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.43%
  • roaring_blaze_2:10.14%
  • roaring_blaze_3:10.60%
  • roaring_blaze_4:15.83%
  • roaring_blaze_5:23.02%
  • roaring_blaze_6:3.71%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.5 38.7 30.2sec 6.1sec 71.77% 70.95% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alythyss
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.49%
  • roaring_blaze_2:10.12%
  • roaring_blaze_3:10.47%
  • roaring_blaze_4:15.65%
  • roaring_blaze_5:22.82%
  • roaring_blaze_6:4.23%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.5 38.8 30.1sec 6.1sec 71.84% 71.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Norgannon's
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.39%
  • roaring_blaze_2:10.00%
  • roaring_blaze_3:10.52%
  • roaring_blaze_4:15.69%
  • roaring_blaze_5:22.89%
  • roaring_blaze_6:4.36%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 37.7 31.3sec 6.3sec 71.21% 70.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:Portal_Pants
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:7.99%
  • roaring_blaze_2:9.98%
  • roaring_blaze_3:10.90%
  • roaring_blaze_4:16.43%
  • roaring_blaze_5:22.70%
  • roaring_blaze_6:3.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.4 38.1 30.6sec 6.2sec 71.70% 70.69% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sindorei_Spite
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.22%
  • roaring_blaze_2:10.07%
  • roaring_blaze_3:10.82%
  • roaring_blaze_4:16.05%
  • roaring_blaze_5:23.09%
  • roaring_blaze_6:3.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.3 37.9 30.9sec 6.2sec 71.57% 70.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:Magistrike's_Restraints
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.12%
  • roaring_blaze_2:10.04%
  • roaring_blaze_3:10.92%
  • roaring_blaze_4:16.21%
  • roaring_blaze_5:23.01%
  • roaring_blaze_6:3.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.4 38.1 30.6sec 6.2sec 71.70% 70.69% 0.0(0.0) 0.0

Buff details

  • buff initial source:Odr
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.18%
  • roaring_blaze_2:10.08%
  • roaring_blaze_3:10.82%
  • roaring_blaze_4:16.07%
  • roaring_blaze_5:23.12%
  • roaring_blaze_6:3.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.6 37.6 29.9sec 6.2sec 71.11% 70.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Feretory_RB
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:9.12%
  • roaring_blaze_2:9.92%
  • roaring_blaze_3:10.17%
  • roaring_blaze_4:15.93%
  • roaring_blaze_5:22.30%
  • roaring_blaze_6:3.67%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.5 38.6 30.3sec 6.1sec 71.74% 70.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:Lessons_of_Space-Time
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.33%
  • roaring_blaze_2:10.08%
  • roaring_blaze_3:10.56%
  • roaring_blaze_4:15.79%
  • roaring_blaze_5:22.94%
  • roaring_blaze_6:4.04%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.2 37.8 31.1sec 6.2sec 71.49% 70.60% 0.0(0.0) 0.0

Buff details

  • buff initial source:Burning_Wish/Whispers
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.05%
  • roaring_blaze_2:9.94%
  • roaring_blaze_3:10.90%
  • roaring_blaze_4:16.40%
  • roaring_blaze_5:22.97%
  • roaring_blaze_6:3.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roaring Blaze 10.5 38.5 30.2sec 6.1sec 71.72% 70.61% 0.0(0.0) 0.0

Buff details

  • buff initial source:Burning_Wish/Metronome
  • cooldown name:buff_roaring_blaze
  • max_stacks:100
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roaring_blaze_1:8.48%
  • roaring_blaze_2:10.43%
  • roaring_blaze_3:10.37%
  • roaring_blaze_4:15.58%
  • roaring_blaze_5:22.97%
  • roaring_blaze_6:3.90%
  • roaring_blaze_7:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205690
  • name:Roaring Blaze
  • tooltip:Damage taken from the Warlock's Immolate increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your remaining Immolate damage on the target by $205690s1% until Immolate expires or is refreshed.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
enemy2
Resource RPS-Gain RPS-Loss
Health 0.00 5748233.10
Combat End Resource Mean Min Max
Health 41422967.29 0.00 97814261.10

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 831
death count pct 8.31
avg death time 308.85
min death time 248.88
max death time 374.70
dmg taken 1730051243.54

Statistics & Data Analysis

Fight Length
Sample Data enemy2 Fight Length
Count 9999
Mean 300.97
Minimum 224.09
Maximum 376.41
Spread ( max - min ) 152.32
Range [ ( max - min ) / 2 * 100% ] 25.31%
DPS
Sample Data enemy2 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data enemy2 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data enemy2 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data enemy2 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data enemy2 Damage Taken Per Second
Count 9999
Mean 5761452.37
Minimum 5453453.60
Maximum 6156337.73
Spread ( max - min ) 702884.13
Range [ ( max - min ) / 2 * 100% ] 6.10%
Standard Deviation 111312.2516
5th Percentile 5591194.10
95th Percentile 5941189.97
( 95th Percentile - 5th Percentile ) 349995.87
Mean Distribution
Standard Deviation 1113.1782
95.00% Confidence Intervall ( 5759270.58 - 5763634.16 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1434
0.1 Scale Factor Error with Delta=300 105771730
0.05 Scale Factor Error with Delta=300 423086917
0.01 Scale Factor Error with Delta=300 10577172918
HPS
Sample Data enemy2 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data enemy2 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data enemy2 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data enemy2 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data enemy2 Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data enemy2Theck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data enemy2 Max Spike Value
Count 2505
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 2143758617 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.